Property Summary

NCBI Gene PubMed Count 10
PubMed Score 25.39
PubTator Score 4.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Lateral sclerosis 15 3.883 1.9

Expression

Gene RIF (2)

AA Sequence

MLITVYCVRRDLSEVTFSLQVSPDFELRNFKVLCEAESRVPVEEIQIIHMERLLIEDHCSLGSYGLKDGD      1 - 70
IVVLLQKDNVGPRAPGRAPNQPRVDFSGIAVPGTSSSRPQHPGQQQQRTPAAQRSQGLASGEKVAGLQGL     71 - 140
GSPALIRSMLLSNPHDLSLLKERNPPLAEALLSGSLETFSQVLMEQQREKALREQERLRLYTADPLDREA    141 - 210
QAKIEEEIRQQNIEENMNIAIEEAPESFGQVTMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMR    211 - 280
LVDRRWAGVAKGVGTQRIIGRVHLAQIQIEGDFLQCSFSILEDQPMDMLLGLDMLRRHQCSIDLKKNVLV    281 - 350
IGTTGTQTYFLPEGELPLCSRMVSGQDESSDKEITHSVMDSGRKEH                            351 - 396
//

Text Mined References (12)

PMID Year Title