Property Summary

NCBI Gene PubMed Count 15
PubMed Score 15.57
PubTator Score 5.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute myeloid leukemia -1.100 2.8e-02
Astrocytoma, Pilocytic 1.100 2.0e-04
atypical teratoid / rhabdoid tumor 1.100 9.3e-05
Chronic Lymphocytic Leukemia 1.202 1.0e-02
colon cancer 1.100 4.0e-03
glioblastoma 1.100 2.4e-04
group 3 medulloblastoma 1.400 1.5e-03
lung cancer 1.800 1.1e-03
ovarian cancer -1.400 3.1e-04
posterior fossa group A ependymoma 1.100 3.2e-06
tuberculosis and treatment for 3 months -1.100 4.3e-04
Waldenstrons macroglobulinemia 1.414 4.4e-03

Gene RIF (5)

AA Sequence

MKARRNKKQIPSFRKLIKTSKVKLENKLKNKQFKQQSTLKKYRKEQRKLRQAVKDAVSKKPIPLENPKEK      1 - 70
RPGKRIEREEEEEEEALPLDMMDEDDLQLMKDLGQRVSFLTRDLSSSEPVHAKKRKHERIIDKYEKIPRT     71 - 140
LQTAPEKELIHLLPIKDKSGIIPQTREKPVTDSNKDEEDQEEERELEEEIIEDPIQELTIEEHLIERKKK    141 - 210
LQEKKMHIAALASAILSDPENNIKKLKELRSMLMEQDPDVAVTVRKLVIVSLMELFKDITPSYKIRPLTE    211 - 280
AEKSTKTRKETQKLREFEEGLVSQYKFYLENLEQMVKDWKQRKLKKSNVVSLKAYKGLAEVAVKSLCELL    281 - 350
VALPHFNFHNNIIVLIVPLMNDMSKLISEMCCEAVKKLFKQDKLGQASLGVIKVISGFVKGRNYEVRPEM    351 - 420
LKTFLCLRIKEVEVKKDTEDINKPKKFMTFKEKRKSLSRMQRKWKKAEEKLERELREAEASESTEKKLKL    421 - 490
HTETLNIVFVTYFRILKKAQRSPLLPAVLEGLAKFAHLINVEFFDDLLVVLHTLIESGDLSYQESLHCVQ    491 - 560
TAFHILSGQGDVLNIDPLKFYTHLYKTLFKLHAGATNEGVEIVLQCLDVMLTKRRKQVSQQRALAFIKRL    561 - 630
CTLALHVLPNSSIGILATTRILMHTFPKTDLLLDSESQGSGVFLPELDEPEYCNAQNTALWELHALRRHY    631 - 700
HPIVQRFAAHLIAGAPSEGSGALKPELSRRSATELFEAYSMAEMTFNPPVESSNPKIKGKFLQGDSFLNE    701 - 770
DLNQLIKRYSSEVATESPLDFTKYLKTSLH                                            771 - 800
//

Text Mined References (20)

PMID Year Title