Property Summary

NCBI Gene PubMed Count 59
Grant Count 49
R01 Count 42
Funding $3,733,607.15
PubMed Score 126.95
PubTator Score 74.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma -1.100 0.000
atypical teratoid/rhabdoid tumor -2.000 0.000
pancreatic ductal adenocarcinoma liver m... -1.359 0.005
active Crohn's disease 1.282 0.007
invasive ductal carcinoma -1.100 0.011
ulcerative colitis 1.200 0.000
ovarian cancer -2.500 0.000
pituitary cancer -1.600 0.000

Synonym

Accession Q8WTS6 B5WWL3 Q0VAH3 Q4W5A9 Q9C0E6
Symbols KMT7
SET7
SET9
SET7/9

Gene

PANTHER Protein Class (2)

PDB

3CBM   3CBO   3CBP   1XQH   1H3I   1MT6   1MUF   1N6A   1N6C   1O9S   2F69   3M53   3M54   3M55   3M56   3M57   3M58   3M59   3M5A   3OS5   3VUZ   3VV0   4E47   4J7F   4J7I   4J83   4J8O   4JDS   4JLG   5AYF   5EG2  

Gene RIF (48)

PMID Text
26890252 Knock-down of SETD7 causes differentiation defects in human embryonic stem cell including delay in both the silencing of pluripotency-related genes and the induction of differentiation genes.
26861389 study identified a novel locus associated with serum lycopene concentrations and results raise a number of possibilities regarding the nature of the relationship between SETD7 and lycopene, both independently associated with prostate cancer.
26701885 Reduced expression of SET7 is associated with gastric cancer progression.
26435321 Lysine methylation by SETD7 is important for the fine-tuning of reactive oxygen species signaling through its regulation on pro-inflammatory responses.
26317544 Unleashed expression of Mdm2 in cancer patients with diminished expression of Set7/9 is associated with poor survival outcome.
26116705 Findings indicate the regulation of Wnt/beta-catenin signaling and the role of SET domain-containing protein 7/9 (SET7/9) in cancer cells.
25954928 Based on our results miR-153 inhibits proliferation and suppresses EMT and the invasive potential of ovarian cancer cells through downregulation of SET7 and ZEB2, supporting the pursuit of miR-153 as a potential target for ovarian cancer intervention.
25681344 Results show that histone-lysine N-methyltransferase Set7 facilitates hepatitis C virus (HCV) replication through the attenuation of interferon-alpha (IFN-alpha) signaling pathways and IFN-related effectors.
25637186 SET9 enriches at hypoxia response elements sites of HIF-1 responsive glycolytic genes and stabilizes HIF-1alpha at these sites in hypoxia.
25472959 Set7-induced epigenetic changes contribute to vascular dysfunction in patients with T2DM.
More...

AA Sequence

MDSDDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGKFFFFDGSTLEGYYVDDALQG      1 - 70
QGVYTYEDGGVLQGTYVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCWIYYPDGGSLVGEVNEDGEMT     71 - 140
GEKIAYVYPDERTALYGKFIDGEMIEGKLATLMSTEEGRPHFELMPGNSVYHFDKSTSSCISTNALLPDP    141 - 210
YESERVYVAESLISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWALNGNTLSLDEETVIDVPEP    211 - 280
YNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAP    281 - 350
EWYQVELKAFQATQQK                                                          351 - 366
//

Text Mined References (65)

PMID Year Title
26890252 2016 SETD7 Regulates the Differentiation of Human Embryonic Stem Cells.
26861389 2016 A Common Variant in the SETD7 Gene Predicts Serum Lycopene Concentrations.
26701885 2016 Reduced expression of SET7/9, a histone mono-methyltransferase, is associated with gastric cancer progression.
26435321 2015 Lysine Methyltransferase SETD7 (SET7/9) Regulates ROS Signaling through mitochondria and NFE2L2/ARE pathway.
26317544 2015 KMT Set7/9 affects genotoxic stress response via the Mdm2 axis.
26116705 2015 SET7/9 regulates cancer cell proliferation by influencing ?-catenin stability.
25954928 2015 MicroRNA-153 functions as a tumor suppressor by targeting SET7 and ZEB2 in ovarian cancer cells.
25681344 2015 Set7 facilitates hepatitis C virus replication via enzymatic activity-dependent attenuation of the IFN-related pathway.
25637186 2015 Functional regulation of hypoxia inducible factor-1? by SET9 lysine methyltransferase.
25472959 2015 Adverse epigenetic signatures by histone methyltransferase Set7 contribute to vascular dysfunction in patients with type 2 diabetes mellitus.
More...