Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.55
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 9.0e-08
group 3 medulloblastoma 4104 5.5e-03
medulloblastoma, large-cell 6241 9.4e-03

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.800 5.5e-03
medulloblastoma, large-cell 1.800 9.4e-03
osteosarcoma -1.656 9.0e-08

AA Sequence

MPVTFALLLLLGQATADPCYDPQGRPQFCLPPVTQLAAVAASCPQACALSPGNHLGARETCNGSLTLALG      1 - 70
GPFLLTSVSLRFCTPGPPALILSAAWASGGPWRLLWHRPAWPGALGGPERVTFHSTPGPKATVAASHLRV     71 - 140
EFGGQAGLAAAGLRGRCQCHGHAARCAARARPPRCHCRHHTTGPGCESCRPSHRDWPWRPATPRHPHPCL    141 - 210
PCSCNQHARRCRFNSELFRLSGGRSGGVCERCRHHTAGRHCHYCQPGFWRDPSQPIFSRRACRACQCHPI    211 - 280
GATGGTCNQTSGQCTCKLGVTGLTCNRCGPGYQQSRSPRMPCQRIPEATTTLATTPGAYSSDPQCQNYCN    281 - 350
MSDTRVHMSLRRYCQQDHVLRAQVLASEAAGPAWQRLAVRVLAVYKQRAQPVRRGDQDAWVPRADLTCGC    351 - 420
LRLQPGTDYLLLGSAVGDPDPTRLILDRHGLALPWRPRWARPLKRLQQEERAGGCRGVRAPTPSPRPEH     421 - 489
//

Text Mined References (3)

PMID Year Title