Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.18
PubTator Score 3.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 2.200 0.000
adrenocortical carcinoma 1.173 0.002
lung cancer 1.900 0.001
group 3 medulloblastoma 1.300 0.001

Synonym

Accession Q8WTR7 A8K8T7 Q9ULS9 Q9Y4Q7
Symbols ZN473
ZFP100

Gene

PDB

2EMB   2EMC   2EME   2EOU   2EOX   2EOY   2EOZ   2YRH   2YRJ   2YSV   2YTD   2YTE   2YTT   2YU5  

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16914750 ZFP100 is the limiting factor for histone pre-mRNA processing in vivo.

AA Sequence

MAEEFVTLKDVGMDFTLGDWEQLGLEQGDTFWDTALDNCQDLFLLDPPRPNLTSHPDGSEDLEPLAGGSP      1 - 70
EATSPDVTETKNSPLMEDFFEEGFSQEIIEMLSKDGFWNSNFGEACIEDTWLDSLLGDPESLLRSDIATN     71 - 140
GESPTECKSHELKRGLSPVSTVSTGEDSMVHNVSEKTLTPAKSKEYRGEFFSYSDHSQQDSVQEGEKPYQ    141 - 210
CSECGKSFSGSYRLTQHWITHTREKPTVHQECEQGFDRNASLSVYPKTHTGYKFYVCNEYGTTFSQSTYL    211 - 280
WHQKTHTGEKPCKSQDSDHPPSHDTQPGEHQKTHTDSKSYNCNECGKAFTRIFHLTRHQKIHTRKRYECS    281 - 350
KCQATFNLRKHLIQHQKTHAAKTTSECQECGKIFRHSSLLIEHQALHAGEEPYKCNERGKSFRHNSTLKI    351 - 420
HQRVHSGEKPYKCSECGKAFHRHTHLNEHRRIHTGYRPHKCQECVRSFSRPSHLMRHQAIHTAEKPYSCA    421 - 490
ECKETFSDNNRLVQHQKMHTVKTPYECQECGERFICGSTLKCHESVHAREKQGFFVSGKILDQNPEQKEK    491 - 560
CFKCNKCEKTFSCSKYLTQHERIHTRGVKPFECDQCGKAFGQSTRLIHHQRIHSRVRLYKWGEQGKAISS    561 - 630
ASLIKLQSFHTKEHPFKCNECGKTFSHSAHLSKHQLIHAGENPFKCSKCDRVFTQRNYLVQHERTHARKK    631 - 700
PLVCNECGKTFRQSSCLSKHQRIHSGEKPYVCDYCGKAFGLSAELVRHQRIHTGEKPYVCQECGKAFTQS    701 - 770
SCLSIHRRVHTGEKPYRCGECGKAFAQKANLTQHQRIHTGEKPYSCNVCGKAFVLSAHLNQHLRVHTQET    771 - 840
LYQCQRCQKAFRCHSSLSRHQRVHNKQQYCL                                           841 - 871
//

Text Mined References (16)

PMID Year Title
26831942 2016 Recent Selection Changes in Human Genes under Long-Term Balancing Selection.
26390436 2015 Integrative Analysis of Transcriptomic and Epigenomic Data to Reveal Regulation Patterns for BMD Variation.
25416956 2014 A proteome-scale map of the human interactome network.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16914750 2006 ZFP100, a component of the active U7 snRNP limiting for histone pre-mRNA processing, is required for entry into S phase.
16714279 2006 Conserved zinc fingers mediate multiple functions of ZFP100, a U7snRNP associated protein.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15824063 2005 U7 snRNP-specific Lsm11 protein: dual binding contacts with the 100 kDa zinc finger processing factor (ZFP100) and a ZFP100-independent function in histone RNA 3' end processing.
More...