Property Summary

NCBI Gene PubMed Count 12
Grant Count 10
R01 Count 7
Funding $2,517,304.11
PubMed Score 16.54
PubTator Score 12.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis -1.300 0.000
osteosarcoma -2.172 0.000
posterior fossa group B ependymoma -1.800 0.000
glioblastoma -1.600 0.000
atypical teratoid/rhabdoid tumor -1.800 0.000
breast carcinoma -1.300 0.001
fibroadenoma -1.600 0.023
adult high grade glioma -1.600 0.000
sonic hedgehog group medulloblastoma -1.200 0.002
ductal carcinoma in situ -1.700 0.001

Gene RIF (2)

PMID Text
22279038 Identification of GDPD5 as a glycerophosphocholine phosphodiesterase that probably participates in the regulation of choline phospholipid metabolism in breast cancer.
17578682 GDPD5 was widely expressed in human tissues and the expression levels in kidney and prostate were relatively low

AA Sequence

MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLTFTFGLTLTWLYFWWEVHNDYD      1 - 70
EFNWYLYNRMGYWSDWPVPILVTTAAAFAYIAGLLVLALCHIAVGQQMNLHWLHKIGLVVILASTVVAMS     71 - 140
AVAQLWEDEWEVLLISLQGTAPFLHVGAVAAVTMLSWIVAGQFARAERTSSQVTILCTFFTVVFALYLAP    141 - 210
LTISSPCIMEKKDLGPKPALIGHRGAPMLAPEHTLMSFRKALEQKLYGLQADITISLDGVPFLMHDTTLR    211 - 280
RTTNVEEEFPELARRPASMLNWTTLQRLNAGQWFLKTDPFWTASSLSPSDHREAQNQSICSLAELLELAK    281 - 350
GNATLLLNLRDPPREHPYRSSFINVTLEAVLHSGFPQHQVMWLPSRQRPLVRKVAPGFQQTSGSKEAVAS    351 - 420
LRRGHIQRLNLRYTQVSRQELRDYASWNLSVNLYTVNAPWLFSLLWCAGVPSVTSDNSHALSQVPSPLWI    421 - 490
MPPDEYCLMWVTADLVSFTLIVGIFVLQKWRLGGIRSYNPEQIMLSAAVRRTSRDVSIMKEKLIFSEISD    491 - 560
GVEVSDVLSVCSDNSYDTYANSTATPVGPRGGGSHTKTLIERSGR                             561 - 605
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22279038 2012 Glycerophosphodiester phosphodiesterase domain containing 5 (GDPD5) expression correlates with malignant choline phospholipid metabolite profiles in human breast cancer.
18667693 2008 GDPD5 is a glycerophosphocholine phosphodiesterase that osmotically regulates the osmoprotective organic osmolyte GPC.
17578682 2008 Cloning and characterization of a human GDPD domain-containing protein GDPD5.
17275818 2007 Involvement of membrane protein GDE2 in retinoic acid-induced neurite formation in Neuro2A cells.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16195461 2005 Transmembrane protein GDE2 induces motor neuron differentiation in vivo.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...