Property Summary

NCBI Gene PubMed Count 11
Grant Count 22
R01 Count 18
Funding $2,208,467.67
PubMed Score 45.18
PubTator Score 7.88

Knowledge Summary

Patent (1,559)

Expression

Gene RIF (6)

PMID Text
22183412 Defects in GRK1 or GRK7 cause patients to suffer from an inability to properly deactivate rhodopsin leading to problems with recovery and dark adaptation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18266817 synthesis of 29 of GRK1 or GRK7 partial peptides that cover the entire sequence of GRK1/GRK7, to see which interacts with recoverin.
15946941 Phosphorylation of GRK1 and GRK7 by PKA occurs in the dark, when cAMP levels in photoreceptor cells are elevated.

AA Sequence

MVDMGALDNLIANTAYLQARKPSDCDSKELQRRRRSLALPGLQGCAELRQKLSLNFHSLCEQQPIGRRLF      1 - 70
RDFLATVPTFRKAATFLEDVQNWELAEEGPTKDSALQGLVATCASAPAPGNPQPFLSQAVATKCQAATTE     71 - 140
EERVAAVTLAKAEAMAFLQEQPFKDFVTSAFYDKFLQWKLFEMQPVSDKYFTEFRVLGKGGFGEVCAVQV    141 - 210
KNTGKMYACKKLDKKRLKKKGGEKMALLEKEILEKVSSPFIVSLAYAFESKTHLCLVMSLMNGGDLKFHI    211 - 280
YNVGTRGLDMSRVIFYSAQIACGMLHLHELGIVYRDMKPENVLLDDLGNCRLSDLGLAVEMKGGKPITQR    281 - 350
AGTNGYMAPEILMEKVSYSYPVDWFAMGCSIYEMVAGRTPFKDYKEKVSKEDLKQRTLQDEVKFQHDNFT    351 - 420
EEAKDICRLFLAKKPEQRLGSREKSDDPRKHHFFKTINFPRLEAGLIEPPFVPDPSVVYAKDIAEIDDFS    421 - 490
EVRGVEFDDKDKQFFKNFATGAVPIAWQEEIIETGLFEELNDPNRPTGCEEGNSSKSGVCLLL           491 - 553
//

Text Mined References (14)

PMID Year Title
22183412 2012 A tale of two kinases in rods and cones.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18803695 2008 Phosphorylation of GRK7 by PKA in cone photoreceptor cells is regulated by light.
18266817 Amino acid residues in GRK1/GRK7 responsible for interaction with S-modulin/recoverin.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17286855 2007 Mapping of transcription start sites of human retina expressed genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15946941 2005 Phosphorylation of GRK1 and GRK7 by cAMP-dependent protein kinase attenuates their enzymatic activities.
More...