Property Summary

NCBI Gene PubMed Count 10
Grant Count 23
R01 Count 14
Funding $1,322,125.59
PubMed Score 37.79
PubTator Score 14.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Crohn's colitis 1 3.571 1.8
Acne 20 3.384 1.7

Gene RIF (3)

PMID Text
21879330 Data suggest an activation of b-defensin-4 induction, in human knee meniscus by the osteoarthritis inflammatory process as a result of an endogenous antibiotic defense mechanism accompanied by an intrinsic effort of tissue remodeling.
21385545 Our results suggest that copy number variation of DEFB4 may not contribute to the pathogenesis of Behcet's disease.
11481241 Beta-defensin 104 displays antimicrobial activity against S. carnosus, E. coli, S. cerevisiae, and P. aeruginosa (strong).

AA Sequence

MQRLVLLLAISLLLYQDLPVRSEFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRT      1 - 70
KP                                                                         71 - 72
//

Text Mined References (11)

PMID Year Title
21879330 2012 Expression of ?-defensin-4 in "an in vivo and ex vivo model" of human osteoarthritic knee meniscus.
21385545 Copy number variation of ?-defensin genes in Behçet's disease.
16033865 2005 Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
15727258 2004 Evidence for duplication of the human defensin gene DEFB4 in chromosomal region 8p22-23 and implications for the analysis of SNP allele distribution.
15588320 2004 Polymorphic segmental duplications at 8p23.1 challenge the determination of individual defensin gene repertoires and the assembly of a contiguous human reference sequence.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12916016 2003 Extensive normal copy number variation of a beta-defensin antimicrobial-gene cluster.
12734011 2003 Duplication and selection in the evolution of primate beta-defensin genes.
12193721 2002 Identification of multiple novel epididymis-specific beta-defensin isoforms in humans and mice.
11854508 2002 Discovery of five conserved beta -defensin gene clusters using a computational search strategy.
More...