Property Summary

NCBI Gene PubMed Count 10
PubMed Score 37.99
PubTator Score 14.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Crohn's colitis 1 3.577 1.8
Acne 52 3.35 1.7

Gene RIF (3)

AA Sequence

MQRLVLLLAISLLLYQDLPVRSEFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRT      1 - 70
KP                                                                         71 - 72
//

Text Mined References (11)

PMID Year Title