Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.38
PubTator Score 1.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Hydrocele 8 3.997 2.0
Inguinal hernia 14 3.381 1.7

Expression

AA Sequence

MIWRGRSTYRPRPRRSVPPPELIGPMLEPGDEEPQQEEPPTESRDPAPGQEREEDQGAAETQVPDLEADL      1 - 70
QELSQSKTGGECGNGPDDQGKILPKSEQFKMPEGGDRQPQV                                  71 - 111
//

Text Mined References (10)

PMID Year Title