Property Summary

NCBI Gene PubMed Count 8
PubMed Score 43.71
PubTator Score 4.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (2)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 7.6e-04
psoriasis 1.400 2.4e-96

Gene RIF (2)

AA Sequence

MVPREAPESAQCLCPSLTIPNAKDVLRKRHKRRSRQHQRFMARKALLQEQGLLSMPPEPGSSPLPTPFGA      1 - 70
ATATEAASSGKQCLRAGSGSAPCSRRPAPGKASGPLPSKCVAIDCEMVGTGPRGRVSELARCSIVSYHGN     71 - 140
VLYDKYIRPEMPIADYRTRWSGITRQHMRKAVPFQVAQKEILKLLKGKVVVGHALHNDFQALKYVHPRSQ    141 - 210
TRDTTYVPNFLSEPGLHTRARVSLKDLALQLLHKKIQVGQHGHSSVEDATTAMELYRLVEVQWEQQEARS    211 - 280
LWTCPEDREPDSSTDMEQYMEDQYWPDDLAHGSRGGAREAQDRRN                             281 - 325
//

Text Mined References (10)

PMID Year Title