Property Summary

NCBI Gene PubMed Count 8
Grant Count 2
R01 Count 2
Funding $53,632
PubMed Score 38.53
PubTator Score 4.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 0.001
psoriasis 1.400 0.000

Synonym

Accession Q8WTP8 C9J571 Q9BSA5 Q9H9X7
Symbols ISG20L1
pp12744

Gene

AEN

 Grant Application (2)

Gene RIF (2)

PMID Text
20429933 identification of ISG20L1 as a p53 family target and discovery that modulation of this target can regulate autophagic processes further strengthens the connection between p53 signaling and autophagy
18264133 AEN is an important downstream mediator of p53 in apoptosis induction in cancer.

AA Sequence

MVPREAPESAQCLCPSLTIPNAKDVLRKRHKRRSRQHQRFMARKALLQEQGLLSMPPEPGSSPLPTPFGA      1 - 70
ATATEAASSGKQCLRAGSGSAPCSRRPAPGKASGPLPSKCVAIDCEMVGTGPRGRVSELARCSIVSYHGN     71 - 140
VLYDKYIRPEMPIADYRTRWSGITRQHMRKAVPFQVAQKEILKLLKGKVVVGHALHNDFQALKYVHPRSQ    141 - 210
TRDTTYVPNFLSEPGLHTRARVSLKDLALQLLHKKIQVGQHGHSSVEDATTAMELYRLVEVQWEQQEARS    211 - 280
LWTCPEDREPDSSTDMEQYMEDQYWPDDLAHGSRGGAREAQDRRN                             281 - 325
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20429933 2010 ISG20L1 is a p53 family target gene that modulates genotoxic stress-induced autophagy.
18264133 2008 p53 target gene AEN is a nuclear exonuclease required for p53-dependent apoptosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16171785 2005 Identification of a novel ionizing radiation-induced nuclease, AEN, and its functional characterization in apoptosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.