Property Summary

NCBI Gene PubMed Count 20
Grant Count 23
R01 Count 19
Funding $1,836,377.77
PubMed Score 42.97
PubTator Score 33.78

Knowledge Summary

Patent (2,918)

Gene RIF (11)

PMID Text
25854549 Haspin kinase plays a key role in maintaining the slowly exchanging centromere Borealin pool.
24732914 Haspin activity affects the phosphorylation state of proteins involved in gene expression regulation and splicing.
23071152 Haspin inhibitors reveal centromeric roles of Aurora B in chromosome movement and spindle checkpoint signaling
21658950 Aurora B phosphorylates Haspin to promote generation of H3T3ph and that Aurora B kinase activity is required for normal chromosomal localization of the CPC, indicating an intimate linkage between Aurora B and Haspin functions in mitosis
20929775 findings show phosphorylation of histone H3-threonine 3 mediated by Haspin cooperates with Bub1-mediated histone 2A-serine 121 phosphorylation in targeting the chromosomal passenger complex to the inner centromere in fission yeast and human cells
20705812 phosphorylation of H3T3 by Haspin is necessary for chromosomal passenger complex(CPC) accumulation at centromeres; Survivin binds to H3T3ph; H3T3ph generated by Haspin positions CPC at centromeres to regulate selected targets of Aurora B during mitosis
20237496 Observational study of gene-disease association. (HuGE Navigator)
19997740 Haspin is a relatively newly discovered kinase that phosphorylates histone H3 during mitosis and appears to play a role in regulating chromosome behavior during cell division. [REVIEW]
19910498 Haspin-depleted cells reveal that spindle-pole integrity in mitosis requires chromosome cohesion.
17084365 Haspin is required to maintain centromeric cohesion during mitosis.
More...

AA Sequence

MAASLPGPGSRLFRTYGAADGRRQRRPGREAAQWFPPQDRRRFFNSSGSSDASIGDPSQSDDPDDPDDPD      1 - 70
FPGSPVRRRRRRPGGRVPKDRPSLTVTPKRWKLRARPSLTVTPRRLGLRARPPQKCSTPCGPLRLPPFPS     71 - 140
RDSGRLSPDLSVCGQPRDGDELGISASLFSSLASPCPGSPTPRDSVISIGTSACLVAASAVPSGLHLPEV    141 - 210
SLDRASLPCSQEEATGGAKDTRMVHQTRASLRSVLFGLMNSGTPEDSEFRADGKNMRESCCKRKLVVGNG    211 - 280
PEGPGLSSTGKRRATGQDSCQERGLQEAVRREHQEASVPKGRIVPRGIDRLERTRSSRKSKHQEATETSL    281 - 350
LHSHRFKKGQKLGKDSFPTQDLTPLQNVCFWTKTRASFSFHKKKIVTDVSEVCSIYTTATSLSGSLLSEC    351 - 420
SNRPVMNRTSGAPSSWHSSSMYLLSPLNTLSISNKKASDAEKVYGECSQKGPVPFSHCLPTEKLQRCEKI    421 - 490
GEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVCNRTEGFIGLN    491 - 560
SVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLFIVLEFEFGGIDLEQMRTKLSSLATAKSILH    561 - 630
QLTASLAVAEASLRFEHRDLHWGNVLLKKTSLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVV    631 - 700
FCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQI    701 - 770
KRKIQEFHRTMLNFSSATDLLCQHSLFK                                              771 - 798
//

Text Mined References (28)

PMID Year Title
25854549 2015 Borealin dimerization mediates optimal CPC checkpoint function by enhancing localization to centromeres and kinetochores.
24732914 2014 Modulation of the chromatin phosphoproteome by the Haspin protein kinase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23071153 2012 A small-molecule inhibitor of Haspin alters the kinetochore functions of Aurora B.
23071152 2012 Haspin inhibitors reveal centromeric functions of Aurora B in chromosome segregation.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
21804608 2012 Antitumor activity of a small-molecule inhibitor of the histone kinase Haspin.
21658950 2011 A positive feedback loop involving Haspin and Aurora B promotes CPC accumulation at centromeres in mitosis.
20929775 2010 Two histone marks establish the inner centromere and chromosome bi-orientation.
20705812 2010 Histone H3 Thr-3 phosphorylation by Haspin positions Aurora B at centromeres in mitosis.
More...