Property Summary

NCBI Gene PubMed Count 23
PubMed Score 49.99
PubTator Score 33.78

Knowledge Summary

Patent (2,918)

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.4e-110
ovarian cancer 8520 5.3e-09
medulloblastoma, large-cell 6241 3.0e-05
primitive neuroectodermal tumor 3035 5.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell 1.600 3.0e-05
ovarian cancer 1.100 5.3e-09
primitive neuroectodermal tumor 1.200 5.6e-03
psoriasis 1.600 1.4e-110

Gene RIF (13)

AA Sequence

MAASLPGPGSRLFRTYGAADGRRQRRPGREAAQWFPPQDRRRFFNSSGSSDASIGDPSQSDDPDDPDDPD      1 - 70
FPGSPVRRRRRRPGGRVPKDRPSLTVTPKRWKLRARPSLTVTPRRLGLRARPPQKCSTPCGPLRLPPFPS     71 - 140
RDSGRLSPDLSVCGQPRDGDELGISASLFSSLASPCPGSPTPRDSVISIGTSACLVAASAVPSGLHLPEV    141 - 210
SLDRASLPCSQEEATGGAKDTRMVHQTRASLRSVLFGLMNSGTPEDSEFRADGKNMRESCCKRKLVVGNG    211 - 280
PEGPGLSSTGKRRATGQDSCQERGLQEAVRREHQEASVPKGRIVPRGIDRLERTRSSRKSKHQEATETSL    281 - 350
LHSHRFKKGQKLGKDSFPTQDLTPLQNVCFWTKTRASFSFHKKKIVTDVSEVCSIYTTATSLSGSLLSEC    351 - 420
SNRPVMNRTSGAPSSWHSSSMYLLSPLNTLSISNKKASDAEKVYGECSQKGPVPFSHCLPTEKLQRCEKI    421 - 490
GEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVCNRTEGFIGLN    491 - 560
SVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLFIVLEFEFGGIDLEQMRTKLSSLATAKSILH    561 - 630
QLTASLAVAEASLRFEHRDLHWGNVLLKKTSLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVV    631 - 700
FCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQI    701 - 770
KRKIQEFHRTMLNFSSATDLLCQHSLFK                                              771 - 798
//

Text Mined References (31)

PMID Year Title