Property Summary

NCBI Gene PubMed Count 20
PubMed Score 103.56
PubTator Score 5.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.400 7.0e-05
astrocytoma 1.200 1.3e-02
atypical teratoid / rhabdoid tumor -1.500 1.7e-05
glioblastoma -1.200 2.7e-07
group 3 medulloblastoma -1.200 9.6e-04
medulloblastoma, large-cell -1.400 8.8e-05
osteosarcoma -2.018 1.2e-06
ovarian cancer -1.100 3.4e-06
primitive neuroectodermal tumor -1.200 2.7e-03
psoriasis -1.100 3.6e-04
subependymal giant cell astrocytoma -1.778 6.2e-03

Protein-protein Interaction (2)

Gene RIF (5)

AA Sequence

MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGS      1 - 70
SGGYGSGGAALQPKGGLFQGGVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDS     71 - 140
SRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPPPPGRRANAPPTPLPMHSSKAPAYNREKPLP    141 - 210
PTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTNESAPELPQRH    211 - 280
NSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAAPPPPPPVIRNGARDAPPPPPPYRMHG    281 - 350
SEPPSRGKPPPPPSRTPAGPPPPPPPPLRNGHRDSITTVRSFLDDFESKYSFHPVEDFPAPEEYKHFQRI    351 - 420
YPSKTNRAARGAPPLPPILR                                                      421 - 440
//

Text Mined References (23)

PMID Year Title