Property Summary

NCBI Gene PubMed Count 19
Grant Count 4
Funding $783,144
PubMed Score 100.94
PubTator Score 5.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis -1.100 0.000
osteosarcoma -2.018 0.000
glioblastoma -1.500 0.000
sonic hedgehog group medulloblastoma -1.800 0.000
astrocytoma 1.300 0.009
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -2.300 0.000
primitive neuroectodermal tumor -1.200 0.003
adult high grade glioma -1.400 0.000
subependymal giant cell astrocytoma -1.778 0.006
ovarian cancer -1.200 0.000

Synonym

Accession Q8TF74 A8K0L3 Q658J8 Q71RE1 Q8TE44
Symbols WICH
WIRE

Gene

Gene RIF (4)

PMID Text
25505242 results support a role for MAP1 proteins in promoting efficient retrograde trafficking of HIV-1 by stimulating the formation of stable microtubules and mediating the association of HIV-1 cores with microtubules.
25505242 WIRE protein interacts weakly with HIV-1 CA cores in primary human macrophages
23295955 Data indicate that the reduced vimentin expression in response to EPHB4, WIPF2 and MTHFD2 silencing was observed at mRNA and protein levels.
12213210 The WASP-binding protein WIRE has a role in the regulation of the actin filament system downstream of the platelet-derived growth factor receptor

AA Sequence

MPIPPPPPPPPGPPPPPTFHQANTEQPKLSRDEQRGRGALLQDICKGTKLKKVTNINDRSAPILEKPKGS      1 - 70
SGGYGSGGAALQPKGGLFQGGVLKLRPVGAKDGSENLAGKPALQIPSSRAAAPRPPVSAASGRPQDDTDS     71 - 140
SRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPPPPGRRANAPPTPLPMHSSKAPAYNREKPLP    141 - 210
PTPGQRLHPGREGPPAPPPVKPPPSPVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTNESAPELPQRH    211 - 280
NSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPPPARDPPSRGAAPPPPPPVIRNGARDAPPPPPPYRMHG    281 - 350
SEPPSRGKPPPPPSRTPAGPPPPPPPPLRNGHRDSITTVRSFLDDFESKYSFHPVEDFPAPEEYKHFQRI    351 - 420
YPSKTNRAARGAPPLPPILR                                                      421 - 440
//

Text Mined References (22)

PMID Year Title
25505242 2015 Microtubule-associated proteins 1 (MAP1) promote human immunodeficiency virus type I (HIV-1) intracytoplasmic routing to the nucleus.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23295955 2013 High-throughput RNAi screening for novel modulators of vimentin expression identifies MTHFD2 as a regulator of breast cancer cell migration and invasion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21706016 2011 Selected reaction monitoring mass spectrometry reveals the dynamics of signaling through the GRB2 adaptor.
20936779 2010 A human MAP kinase interactome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...