Property Summary

NCBI Gene PubMed Count 16
Grant Count 21
R01 Count 14
Funding $1,884,642.37
PubMed Score 44.90
PubTator Score 27.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Leukemia 88 3.341 1.7
Osteoporosis 257 3.308 1.7

Expression

Gene RIF (5)

PMID Text
21504714 Rare translocation t(12;17)(p13;q12), This translocation has been reported in 25 cases and its putative molecular consequence, the formation of a TAF15-ZNF384 fusion gene, in only six cases.
19426707 These results suggest that caspase-mediated degradation may represent a novel regulatory mechanism that controls TAF15 and TAF15-CIZ/NMP4 activities.
15990865 The CIZ protein(also known as ZNF384)was involved and rearrangemented in acute leukemia.
12359745 The transcription factor gene CIZ/NMP4 is recurrently involved in acute leukemia through fusion with either EWSR1 or TAF15.
11956602 expression in pelvic lymph nodes and primary tumors in early stage cervical carcinomas

AA Sequence

MEESHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVSLPSGISMDTE      1 - 70
SKSDQLTPHSQASVTQNITVVPVPSTGLMTAGVSCSQRWRREGSQSRGPGLVITSPSGSLVTTASSAQTF     71 - 140
PISAPMIVSALPPGSQALQVVPDLSKKVASTLTEEGGGGGGGGGSVAPKPPRGRKKKRMLESGLPEMNDP    141 - 210
YVLSPEDDDDHQKDGKTYRCRMCSLTFYSKSEMQIHSKSHTETKPHKCPHCSKTFANSSYLAQHIRIHSG    211 - 280
AKPYSCNFCEKSFRQLSHLQQHTRIHSKMHTETIKPHKCPHCSKTFANTSYLAQHLRIHSGAKPYNCSYC    281 - 350
QKAFRQLSHLQQHTRIHTGDRPYKCAHPGCEKAFTQLSNLQSHRRQHNKDKPFKCHNCHRAYTDAASLEV    351 - 420
HLSTHTVKHAKVYTCTICSRAYTSETYLMKHMRKHNPPDLQQQVQAAAAAAAVAQAQAQAQAQAQAQAQA    421 - 490
QAQAQASQASQQQQQQQQQQQQQQQQPPPHFQSPGAAPQGGGGGDSNPNPPPQCSFDLTPYKTAEHHKDI    491 - 560
CLTVTTSTIQVEHLASS                                                         561 - 577
//

Text Mined References (20)

PMID Year Title
21504714 2011 Identification of the TAF15-ZNF384 fusion gene in two new cases of acute lymphoblastic leukemia with a t(12;17)(p13;q12).
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19426707 2009 TAF15 and the leukemia-associated fusion protein TAF15-CIZ/NMP4 are cleaved by caspases-3 and -7.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18185522 2008 E2A-ZNF384 and NOL1-E2A fusion created by a cryptic t(12;19)(p13.3; p13.3) in acute leukemia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16541075 2006 The finished DNA sequence of human chromosome 12.
16510139 2006 Interaction partners for human ZNF384/CIZ/NMP4--zyxin as a mediator for p130CAS signaling?
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15990865 2005 CIZ gene rearrangements in acute leukemia: report of a diagnostic FISH assay and clinical features of nine patients.
More...