Property Summary

NCBI Gene PubMed Count 11
PubMed Score 269.59
PubTator Score 27.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Breast cancer 2.700 4.7e-02
breast carcinoma 1.400 2.1e-04
colon cancer 2.300 1.0e-03
ductal carcinoma in situ 2.700 2.3e-03
invasive ductal carcinoma 3.658 1.5e-04
lung adenocarcinoma 1.200 1.8e-03
non-small cell lung cancer 2.243 4.1e-12
osteosarcoma 1.252 2.5e-03
ovarian cancer 1.400 2.0e-03
pancreatic cancer 1.400 1.6e-03
primary pancreatic ductal adenocarcinoma 1.268 3.8e-03

Gene RIF (4)

AA Sequence

MPLKHYLLLLVGCQAWGAGLAYHGCPSECTCSRASQVECTGARIVAVPTPLPWNAMSLQILNTHITELNE      1 - 70
SPFLNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGLFQGLDSLESLLLSSNQLLQI     71 - 140
QPAHFSQCSNLKELQLHGNHLEYIPDGAFDHLVGLTKLNLGKNSLTHISPRVFQHLGNLQVLRLYENRLT    141 - 210
DIPMGTFDGLVNLQELALQQNQIGLLSPGLFHNNHNLQRLYLSNNHISQLPPSVFMQLPQLNRLTLFGNS    211 - 280
LKELSPGIFGPMPNLRELWLYDNHISSLPDNVFSNLRQLQVLILSRNQISFISPGAFNGLTELRELSLHT    281 - 350
NALQDLDGNVFRMLANLQNISLQNNRLRQLPGNIFANVNGLMAIQLQNNQLENLPLGIFDHLGKLCELRL    351 - 420
YDNPWRCDSDILPLRNWLLLNQPRLGTDTVPVCFSPANVRGQSLIIINVNVAVPSVHVPEVPSYPETPWY    421 - 490
PDTPSYPDTTSVSSTTELTSPVEDYTDLTTIQVTDDRSVWGMTQAQSGLAIAAIVIGIVALACSLAACVG    491 - 560
CCCCKKRSQAVLMQMKAPNEC                                                     561 - 581
//

Text Mined References (12)

PMID Year Title