Property Summary

NCBI Gene PubMed Count 10
PubMed Score 224.49
PubTator Score 27.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
breast carcinoma 1614 5.39540173271167E-21
Breast cancer 3099 6.13305488729242E-13
non-small cell lung cancer 2798 4.05125124844836E-12
invasive ductal carcinoma 2950 1.52164800196075E-4
colon cancer 1475 0.00104971999128081
pancreatic cancer 2300 0.00155528247217803
lung adenocarcinoma 2714 0.00184388895281854
ductal carcinoma in situ 1745 0.00232050686132257
osteosarcoma 7933 0.00247768888536252
primary pancreatic ductal adenocarcinoma 1271 0.00379881273537197
ovarian cancer 8492 0.00599514484557229
Disease Target Count Z-score Confidence
Waterhouse-Friderichsen syndrome 11 3.479 1.7
Batten disease 15 3.238 1.6

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma 1.252 0.002
primary pancreatic ductal adenocarcinoma 1.268 0.004
non-small cell lung cancer 2.243 0.000
colon cancer 2.300 0.001
pancreatic cancer 1.400 0.002
breast carcinoma 1.700 0.000
Breast cancer 3.100 0.000
lung adenocarcinoma 1.200 0.002
invasive ductal carcinoma 3.658 0.000
ductal carcinoma in situ 2.700 0.002
ovarian cancer 2.400 0.006

Synonym

Accession Q8TF66 Q495Q6 Q7RTN7
Symbols LIB

Gene

  Ortholog (6)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Pathway (1)

Gene RIF (3)

PMID Text
18385238 Tumor antigen LRRC15 impedes adenoviral infection: implications for virus-based cancer therapy are presented.
16098915 Lib may contribute to regulation of cell-matrix adhesion interactions with respect to astrocyte recruitment around senile plaques in Alzheimer's disease brain
12923058 LRRC15 is induced by EWS-WT1(+KTS) in the tumor DSRCT and may play a role in cellular invasion.

AA Sequence

MPLKHYLLLLVGCQAWGAGLAYHGCPSECTCSRASQVECTGARIVAVPTPLPWNAMSLQILNTHITELNE      1 - 70
SPFLNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGLFQGLDSLESLLLSSNQLLQI     71 - 140
QPAHFSQCSNLKELQLHGNHLEYIPDGAFDHLVGLTKLNLGKNSLTHISPRVFQHLGNLQVLRLYENRLT    141 - 210
DIPMGTFDGLVNLQELALQQNQIGLLSPGLFHNNHNLQRLYLSNNHISQLPPSVFMQLPQLNRLTLFGNS    211 - 280
LKELSPGIFGPMPNLRELWLYDNHISSLPDNVFSNLRQLQVLILSRNQISFISPGAFNGLTELRELSLHT    281 - 350
NALQDLDGNVFRMLANLQNISLQNNRLRQLPGNIFANVNGLMAIQLQNNQLENLPLGIFDHLGKLCELRL    351 - 420
YDNPWRCDSDILPLRNWLLLNQPRLGTDTVPVCFSPANVRGQSLIIINVNVAVPSVHVPEVPSYPETPWY    421 - 490
PDTPSYPDTTSVSSTTELTSPVEDYTDLTTIQVTDDRSVWGMTQAQSGLAIAAIVIGIVALACSLAACVG    491 - 560
CCCCKKRSQAVLMQMKAPNEC                                                     561 - 581
//

Text Mined References (11)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18385238 2008 Tumor antigen LRRC15 impedes adenoviral infection: implications for virus-based cancer therapy.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16098915 2005 Lib, transcriptionally induced in senile plaque-associated astrocytes, promotes glial migration through extracellular matrix.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12923058 2003 Identification of a DNA-binding site and transcriptional target for the EWS-WT1(+KTS) oncoprotein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...