Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.94
PubTator Score 5.00

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (7)

AA Sequence

MHYGAATHIQNSRSHGLETVPGHQRLERGAGGETPEFPGCHSPAPPENFGNELLPLSAPLQGLSEGLYPP      1 - 70
GRNKTLPAGVLREGAVQFLHRGLCNSNLSSEASARPSGTQDELHSSRRKTGQTRREGARKHLVCSFRLYP     71 - 140
FTVHTVSPGNSHLALYQVFKAVKLCPSETSFFLSRKSLKSSDPWHPPSLSPNSWNRQAGFRAWSSHLISL    141 - 210
SLTCSDSQSRRVSSSQQPPLHSLSSHRRAAHVPE                                        211 - 244
//

Text Mined References (14)

PMID Year Title