Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.08
PubTator Score 5.00

Knowledge Summary

Patent

No data available

Gene RIF (7)

PMID Text
23619526 In the Han Chinese population, common DCNP1 polymorphisms are unlikely to be important in the genetic susceptibility to MDD.
20693543 We propose that full-length dendritic cell nucleus protein-1 may play a role in the pathogenesis of depressive disorders by enhancing corticotropin-releasing hormone expression in the hypothalamic paraventricular nucleus.
20351714 Observational study of gene-disease association. (HuGE Navigator)
17460725 Observational study of gene-disease association. (HuGE Navigator)
17460725 the genetic polymorphism of DCNP1 may influence production of specific IgE by altering DC (Dendritic Cells)functions in the mite allergen presenting and/or processing.
16189510 Marker rs12520799, in dendritic cell nuclear protein 1 on chromosome 5, yielded a significant association with lifetime major depression.
11798177 molecular cloning and immunocytochemical analysis

AA Sequence

MHYGAATHIQNSRSHGLETVPGHQRLERGAGGETPEFPGCHSPAPPENFGNELLPLSAPLQGLSEGLYPP      1 - 70
GRNKTLPAGVLREGAVQFLHRGLCNSNLSSEASARPSGTQDELHSSRRKTGQTRREGARKHLVCSFRLYP     71 - 140
FTVHTVSPGNSHLALYQVFKAVKLCPSETSFFLSRKSLKSSDPWHPPSLSPNSWNRQAGFRAWSSHLISL    141 - 210
SLTCSDSQSRRVSSSQQPPLHSLSSHRRAAHVPE                                        211 - 244
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23619526 2013 Lack of association between dendritic cell nuclear protein-1 gene and major depressive disorder in the Han Chinese population.
20693543 2010 Dendritic cell nuclear protein-1, a novel depression-related protein, upregulates corticotropin-releasing hormone expression.
20351714 2011 Poor replication of candidate genes for major depressive disorder using genome-wide association data.
17460725 2007 A promoter nucleotide variant of the dendritic cell-specific DCNP1 associates with serum IgE levels specific for dust mite allergens among the Korean asthmatics.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16189510 2006 DCNP1: a novel candidate gene for major depression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...