Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.22
PubTator Score 2.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -3.300 0.000
psoriasis -1.300 0.002
osteosarcoma -3.913 0.000
interstitial cystitis 1.100 0.002
pilocytic astrocytoma 1.300 0.000
non primary Sjogren syndrome sicca -1.200 0.025
lung carcinoma -1.200 0.000
spina bifida 1.676 0.030
ductal carcinoma in situ -1.200 0.002
invasive ductal carcinoma -1.500 0.001
Gaucher disease type 3 -1.500 0.041

Synonym

Accession Q8TF62 Q9H727
Symbols ATPIM

Gene

PANTHER Protein Class (2)

Gene RIF (3)

PMID Text
26473621 ATP8B4 gene was associated with a significant increase in the risk of systemic sclerosis. ATP8B4 is overexpressed in systemic sclerosis patients.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17998437 Genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MFCSEKKLREVERIVKANDREYNEKFQYADNRIHTSKYNILTFLPINLFEQFQRVANAYFLCLLILQLIP      1 - 70
EISSLTWFTTIVPLVLVITMTAVKDATDDYFRHKSDNQVNNRQSEVLINSKLQNEKWMNVKVGDIIKLEN     71 - 140
NQFVAADLLLLSSSEPHGLCYVETAELDGETNLKVRHALSVTSELGADISRLAGFDGIVVCEVPNNKLDK    141 - 210
FMGILSWKDSKHSLNNEKIILRGCILRNTSWCFGMVIFAGPDTKLMQNSGKTKFKRTSIDRLMNTLVLWI    211 - 280
FGFLICLGIILAIGNSIWESQTGDQFRTFLFWNEGEKSSVFSGFLTFWSYIIILNTVVPISLYVSVEVIR    281 - 350
LGHSYFINWDRKMYYSRKAIPAVARTTTLNEELGQIEYIFSDKTGTLTQNIMTFKRCSINGRIYGEVHDD    351 - 420
LDQKTEITQEKEPVDFSVKSQADREFQFFDHHLMESIKMGDPKVHEFLRLLALCHTVMSEENSAGELIYQ    421 - 490
VQSPDEGALVTAARNFGFIFKSRTPETITIEELGTLVTYQLLAFLDFNNTRKRMSVIVRNPEGQIKLYSK    491 - 560
GADTILFEKLHPSNEVLLSLTSDHLSEFAGEGLRTLAIAYRDLDDKYFKEWHKMLEDANAATEERDERIA    561 - 630
GLYEEIERDLMLLGATAVEDKLQEGVIETVTSLSLANIKIWVLTGDKQETAINIGYACNMLTDDMNDVFV    631 - 700
IAGNNAVEVREELRKAKQNLFGQNRNFSNGHVVCEKKQQLELDSIVEETITGDYALIINGHSLAHALESD    701 - 770
VKNDLLELACMCKTVICCRVTPLQKAQVVELVKKYRNAVTLAIGDGANDVSMIKSAHIGVGISGQEGLQA    771 - 840
VLASDYSFAQFRYLQRLLLVHGRWSYFRMCKFLCYFFYKNFAFTLVHFWFGFFCGFSAQTVYDQWFITLF    841 - 910
NIVYTSLPVLAMGIFDQDVSDQNSVDCPQLYKPGQLNLLFNKRKFFICVLHGIYTSLVLFFIPYGAFYNV    911 - 980
AGEDGQHIADYQSFAVTMATSLVIVVSVQIALDTSYWTFINHVFIWGSIAIYFSILFTMHSNGIFGIFPN    981 - 1050
QFPFVGNARHSLTQKCIWLVILLTTVASVMPVVAFRFLKVDLYPTLSDQIRRWQKAQKKARPPSSRRPRT   1051 - 1120
RRSSSRRSGYAFAHQEGYGELITSGKNMRAKNPPPTSGLEKTHYNSTSWIENLCKKTTDTVSSFSQDKTV   1121 - 1190
KL                                                                       1191 - 1192
//

Text Mined References (13)

PMID Year Title
26473621 2016 Identification of Rare Variants in ATP8B4 as a Risk Factor for Systemic Sclerosis by Whole-Exome Sequencing.
23087808 2012 Translocation t(11;14) (q13;q32) and genomic imbalances in multi-ethnic multiple myeloma patients: a Malaysian study.
20961850 2010 CDC50 proteins are critical components of the human class-1 P4-ATPase transport machinery.
20947505 2010 Heteromeric interactions required for abundance and subcellular localization of human CDC50 proteins and class 1 P4-ATPases.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17998437 2008 Candidate single-nucleotide polymorphisms from a genomewide association study of Alzheimer disease.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12880872 2003 FIC1, a P-type ATPase linked to cholestatic liver disease, has homologues (ATP8B2 and ATP8B3) expressed throughout the body.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...