Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.22
PubTator Score 2.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
astrocytic glioma -1.900 0.004
posterior fossa group A ependymoma -3.600 0.000
oligodendroglioma -1.500 0.000
psoriasis -1.600 0.000
glioblastoma -3.600 0.000
osteosarcoma -2.459 0.000
medulloblastoma -2.800 0.000
atypical teratoid / rhabdoid tumor -3.600 0.000
medulloblastoma, large-cell -2.400 0.000
primitive neuroectodermal tumor -2.500 0.000
tuberculosis 1.700 0.000
pediatric high grade glioma -2.900 0.000
pilocytic astrocytoma -2.700 0.000
subependymal giant cell astrocytoma -2.385 0.047
lung adenocarcinoma 1.100 0.000

Gene RIF (2)

PMID Text
26063905 This study show that FBXO41 is a critical factor, not only for neuronal migration in the cerebellum, but also for its long-term integrity.
23777664 Our finding suggests that the FBXO41gene may be a non-X chromosome-related Parkinson disease risk factor

AA Sequence

MASLDLPYRCPRCGEHKRFRSLSSLRAHLEYSHTYETLYILSKTNSICDGAAAAAAAAAAASGFPLAPEP      1 - 70
AALLAVPGARREVFESTSFQGKEQAAGPSPAAPHLLHHHHHHAPLAHFPGDLVPASLPCEELAEPGLVPA     71 - 140
AAARYALREIEIPLGELFARKSVASSACSTPPPGPGPGPCPGPASASPASPSPADVAYEEGLARLKIRAL    141 - 210
EKLEVDRRLERLSEEVEQKIAGQVGRLQAELERKAAELETARQESARLGREKEELEERASELSRQVDVSV    211 - 280
ELLASLKQDLVHKEQELSRKQQEVVQIDQFLKETAAREASAKLRLQQFIEELLERADRAERQLQVISSSC    281 - 350
GSTPSASLGRGGGGGGAGPNARGPGRMREHHVGPAVPNTYAVSRHGSSPSTGASSRVPAASQSSGCYDSD    351 - 420
SLELPRPEEGAPEDSGPGGLGTRAQAANGGSERSQPPRSSGLRRQAIQNWQRRPRRHSTEGEEGDVSDVG    421 - 490
SRTTESEAEGPLDAPRPGPAMAGPLSSCRLSARPEGGSGRGRRAERVSPSRSNEVISPEILKMRAALFCI    491 - 560
FTYLDTRTLLHAAEVCRDWRFVARHPAVWTRVLLENARVCSKFLAMLAQWCTQAHSLTLQNLKPRQRGKK    561 - 630
ESKEEYARSTRGCLEAGLESLLKAAGGNLLILRISHCPNILTDRSLWLASCYCRALQAVTYRSATDPVGH    631 - 700
EVIWALGAGCREIVSLQVAPLHPCQQPTRFSNRCLQMIGRCWPHLRALGVGGAGCGVQGLASLARNCMRL    701 - 770
QVLELDHVSEITQEVAAEVCREGLKGLEMLVLTATPVTPKALLHFNSICRNLKSIVVQIGIADYFKEPSS    771 - 840
PEAQKLFEDMVTKLQALRRRPGFSKILHIKVEGGC                                       841 - 875
//

Text Mined References (9)

PMID Year Title
26063905 2015 Loss of the neuron-specific F-box protein FBXO41 models an ataxia-like phenotype in mice with neuronal migration defects and degeneration in the cerebellum.
23777664 2013 Genetic analysis of the F-box only protein 41 gene in Chinese Han patients with Parkinson's disease.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15070733 2004 M-phase kinases induce phospho-dependent ubiquitination of somatic Wee1 by SCFbeta-TrCP.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11853319 2001 Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins.