Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.07
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Obesity 616
Disease Target Count P-value
osteosarcoma 7933 1.86140004187949E-7
breast carcinoma 1614 0.00455632512377809
fibroadenoma 557 0.0345706790584375

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.800 0.000
breast carcinoma -1.300 0.005
fibroadenoma -1.900 0.035

Synonym

Accession Q8TF44 Q8N3H7
Symbols NLF3
FAM148C
KIAA1957

Gene

  Ortholog (12)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG
Zebrafish OMA Inparanoid

AA Sequence

MRKTNMWFLERLRGSGENGAARGVGSEAGDKASKGPLYSNVLTPDKIPDFFIPPKLPSGPAEGEGQAALG      1 - 70
PSTSEQNLASAAPRQTPRSPRLPAKLAAESKSLLKAATRHVIQIESAEDWLSEEATDADPQAQGAMSLPS     71 - 140
VPKAQTSYGFAMLAESPHTRRKESLFHSEHGALAQVGSPGAGRRRAAAKANGGDGGPREAGGALMSPGRY    141 - 210
FSGGESDTGSSAESSPFGSPLLSRSVSLLKGFAQDSQAKVSQLRHSVGRHGSLSADDSTPDASPGSRRRL    211 - 280
TRRAPPEPGPESGQARGEHTVHVGPRGSVRLLAEYEAGQARLRVHLLAAEGLYDRLCDARSINCCVGLCL    281 - 350
VPGKLQKQRSTIVKNSRRPVFNEDFFFDGLGPASVRKLALRIKVVNKGSSLKRDTLLGEKELPLTSLLPF    351 - 420
L//

Text Mined References (5)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15527968 2004 A novel gene family induced by acute inflammation in endothelial cells.
11853319 2001 Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins.