Property Summary

NCBI Gene PubMed Count 27
PubMed Score 48.93
PubTator Score 155.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -1.600 6.5e-03
astrocytic glioma -2.100 8.4e-03
Atopic dermatitis -1.200 1.5e-04
atypical teratoid / rhabdoid tumor -2.200 4.3e-04
chronic lymphosyte leukemia 1.700 3.1e-04
cystic fibrosis 1.100 3.7e-04
ependymoma -2.300 1.6e-02
glioblastoma -1.300 1.8e-03
group 3 medulloblastoma -2.100 1.9e-02
Hydrolethalus syndrome 1.157 2.2e-02
lung carcinoma -1.800 4.2e-18
medulloblastoma, large-cell -3.300 4.5e-04
non diabetic and post-ischemic heart fai... -1.500 7.7e-03
non-small cell lung cancer -1.413 9.5e-14
oligodendroglioma -2.300 6.7e-03
osteosarcoma -2.198 4.4e-09
pancreatic cancer 1.300 6.5e-04
Rheumatoid arthritis 1.300 3.7e-03
subependymal giant cell astrocytoma -2.597 5.0e-03
tuberculosis 1.100 7.8e-06

Gene RIF (13)

AA Sequence

MAQYGHPSPLGMAAREELYSKVTPRRNRQQRPGTIKHGSALDVLLSMGFPRARAQKALASTGGRSVQAAC      1 - 70
DWLFSHVGDPFLDDPLPREYVLYLRPTGPLAQKLSDFWQQSKQICGKNKAHNIFPHITLCQFFMCEDSKV     71 - 140
DALGEALQTTVSRWKCKFSAPLPLELYTSSNFIGLFVKEDSAEVLKKFAADFAAEAASKTEVHVEPHKKQ    141 - 210
LHVTLAYHFQASHLPTLEKLAQNIDVKLGCDWVATIFSRDIRFANHETLQVIYPYTPQNDDELELVPGDF    211 - 280
IFMSPMEQTSTSEGWIYGTSLTTGCSGLLPENYITKADECSTWIFHGSYSILNTSSSNSLTFGDGVLERR    281 - 350
PYEDQGLGETTPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLN    351 - 420
MPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHNILKGLQQENH    421 - 490
LKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEI    491 - 560
ISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQLTDPPIL    561 - 630
PLTHGPTGGFNWRETLLQE                                                       631 - 649
//

Text Mined References (30)

PMID Year Title