Property Summary

NCBI Gene PubMed Count 25
Grant Count 254
R01 Count 201
Funding $15,216,784.33
PubMed Score 45.10
PubTator Score 155.12

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8TF42 Q53GT5 Q53GT8 Q8NBV7 Q96IG9 Q96NZ2
Symbols p70
STS1
STS-1
TULA2
TULA-2

Gene

PDB

2CPW   2E5K  

Gene RIF (11)

PMID Text
26766443 targeting Aurora B to microtubules by UBASH3B is necessary for the timing and fidelity of chromosome segregation in human cells
26516227 These results show that TULA-2 is a target of miR-148a-3p
26449661 The study reveals a role of CBL in restricting myeloid proliferation of human AML1-ETOinduced leukemia, and identifies UBASH3B as a potential target for pharmaceutical intervention.
25959715 results demonstrate the importance of STS-1 in regulating IFN-alpha-induced autophagy in B cells
25271148 This recovery involves the phosphorylation of p70 independent of mTOR.
23784775 UBASH3B is a functional target of anti-invasive microRNA200a that is down-regulated in triple negative breast cancer. Importantly, the oncogenic potential of UBASH3B is dependent on its tyrosine phosphatase activity.
20585042 Ablation of TULA-2 resulted in hyperphosphorylation of Syk and its downstream effector phospholipase C-gamma2 as well as enhanced GPVI-mediated platelet functional responses.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18189269 TULA proteins TULA and TULA-2 regulate activity of the protein tyrosine kinase Syk
15388581 hsp70 inhibits apoptosis upstream and downstream of the mitochondria and is a promising therapeutic target for reversing drug-resistance in chronic myeloid leukemia-blast crisis and acute myeloid leukemia cells.
More...

AA Sequence

MAQYGHPSPLGMAAREELYSKVTPRRNRQQRPGTIKHGSALDVLLSMGFPRARAQKALASTGGRSVQAAC      1 - 70
DWLFSHVGDPFLDDPLPREYVLYLRPTGPLAQKLSDFWQQSKQICGKNKAHNIFPHITLCQFFMCEDSKV     71 - 140
DALGEALQTTVSRWKCKFSAPLPLELYTSSNFIGLFVKEDSAEVLKKFAADFAAEAASKTEVHVEPHKKQ    141 - 210
LHVTLAYHFQASHLPTLEKLAQNIDVKLGCDWVATIFSRDIRFANHETLQVIYPYTPQNDDELELVPGDF    211 - 280
IFMSPMEQTSTSEGWIYGTSLTTGCSGLLPENYITKADECSTWIFHGSYSILNTSSSNSLTFGDGVLERR    281 - 350
PYEDQGLGETTPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLN    351 - 420
MPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHNILKGLQQENH    421 - 490
LKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEI    491 - 560
ISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQLTDPPIL    561 - 630
PLTHGPTGGFNWRETLLQE                                                       631 - 649
//

Text Mined References (27)

PMID Year Title
26766443 2016 Ubiquitin Receptor Protein UBASH3B Drives Aurora B Recruitment to Mitotic Microtubules.
26516227 2015 Anti-miR-148a regulates platelet Fc?RIIA signaling and decreases thrombosis in vivo in mice.
26449661 2016 UBASH3B/Sts-1-CBL axis regulates myeloid proliferation in human preleukemia induced by AML1-ETO.
25959715 2015 STS-1 promotes IFN-? induced autophagy by activating the JAK1-STAT1 signaling pathway in B cells.
25416956 2014 A proteome-scale map of the human interactome network.
25271148 2015 Placenta growth factor induces invasion and activates p70 during rapamycin treatment in trophoblast cells.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23784775 2013 Protein tyrosine phosphatase UBASH3B is overexpressed in triple-negative breast cancer and promotes invasion and metastasis.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20585042 2010 A novel histidine tyrosine phosphatase, TULA-2, associates with Syk and negatively regulates GPVI signaling in platelets.
More...