Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.78
PubTator Score 0.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
gastric cancer 1.100 0.007
astrocytic glioma 1.400 0.001
ependymoma 1.600 0.007
oligodendroglioma 1.500 0.000
glioblastoma 1.300 0.000
osteosarcoma -2.272 0.000
group 4 medulloblastoma 2.600 0.000
medulloblastoma, large-cell 1.900 0.001
primitive neuroectodermal tumor 2.000 0.000
acute quadriplegic myopathy 1.060 0.000
sarcoidosis -1.100 0.006
adult high grade glioma 1.500 0.003
non primary Sjogren syndrome sicca -1.200 0.021
aldosterone-producing adenoma -1.796 0.018
spina bifida -2.701 0.028
Pick disease 1.300 0.000

AA Sequence

MDDLKYGVYPLKEASGCPGAERNLLVYSYFEKETLTFRDVAIEFSLEEWECLNPAQQNLYMNVMLENYKN      1 - 70
LVFLGVAVSKQDPVTCLEQEKEPWNMKRHEMVDEPPAMCSYFTKDLWPEQDIKDSFQQVILRRYGKCEHE     71 - 140
NLQLRKGSASVDEYKVHKEGYNELNQCLTTTQSKIFPCDKYVKVFHKFLNANRHKTRHTGKKPFKCKKCG    141 - 210
KSFCMLLHLSQHKRIHIRENSYQCEECGKAFKWFSTLTRHKRIHTGEKPFKCEECGKAFKQSSTLTTHKI    211 - 280
IHTGEKPYRCEECGKAFNRSSHLTTHKIIHTGEKPYKCEECGKAFNQSSTLSTHKFIHAGEKPYKCEECD    281 - 350
KAFNRFSYLTKHKIIHTGEKSYKCEECGKGFNWSSTLTKHKRIHTGEKPYKCEVCGKAFNESSNLTTHKM    351 - 420
IHTGEKPYKCEECGKAFNRSPQLTAHKIIHTGEKPYKCEECGKAFSQSSILTTHKRIHTGEKPYKCEECG    421 - 490
KAFNRSSNLTKHKIIHTGEKSYKCEECGKAFNQSSTLTKHRKIHTRQKPYNCEECDNTFNQSSNLIKQNN    491 - 560
SYWRETLQMSRMWESL                                                          561 - 576
//

Text Mined References (8)

PMID Year Title
22750566 2012 GWAS reveals new recessive loci associated with non-syndromic facial clefting.
21177534 2011 A novel KRAB domain-containing zinc finger transcription factor ZNF431 directly represses Patched1 transcription.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11853319 2001 Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.