Property Summary

NCBI Gene PubMed Count 9
PubMed Score 12.09
PubTator Score 9.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia 1.200 1.2e-02
medulloblastoma, large-cell -1.800 1.6e-05
osteosarcoma -3.384 7.9e-11
ovarian cancer -1.400 2.6e-05
tuberculosis and treatment for 6 months 1.400 9.4e-04

Gene RIF (3)

AA Sequence

MEDEQPDSLEGWVPVREGLFAEPERHRLRFLVAWNGAEGKFAVTCHDRTAQQRRLREGARLGPEPEPKPE      1 - 70
AAVSPSSWAGLLSAAGLRGAHRQLAALWPPLERCFPRLPPELDVGGGGAWGLGLGLWALLWPTRAGPGEA     71 - 140
ALQELCGQLERYLGAAADGCGGATVRDALFPAEGGAADCESPREFRERALRARWVEADARLRQVIQGHGK    141 - 210
ANTMVALMNVYQEEDEAYQELVTVATMFFQYLLQPFRAMREVATLCKLDILKSLDEDDLGPRRVVALEKE    211 - 280
AEEWTRRAEEAVVSIQDITVNYFKETVKALAGMQKEMEQDAKRFGQAAWATAIPRLEKLQLMLARETLQL    281 - 350
MRAKELCLNHKRAEIQGKMEDLPEQEKNTNVVDELEIQFYEIQLELYEVKFEILKNEEILLTTQLDSLKR    351 - 420
LIKEKQDEVVYYDPCENPEELKVIDCVVGLQDDKNLEVKELRRQCQQLESKRGRICAKRASLRSRKDQCK    421 - 490
ENHRFRLQQAEESIRYSRQHHSIQMKRDKIKEEEQKKKEWINQERQKTLQRLRSFKDKRLAQSVRNTSGS    491 - 560
EPVAPNLPSDLSQQMCLPASHAVSVIHPSSRKTRGVPLSEAGNVKSPKCQNCHGNIPVQVFVPVGDQTHS    561 - 630
KSSEELSLPPPPPPPPPPPPPPPPPPPPLRALSSSSQAATHQNLGFRAPVKDDQPRPLVCESPAERPRDS    631 - 700
LESFSCPGSMDEVLASLRHGRAPLRKVEVPAVRPPHASINEHILAAIRQGVKLKKVHPDLGPNPSSKPTS    701 - 770
NRRTSDLERSIKAALQRIKRVSADSEEDSDEQDPGQWDG                                   771 - 809
//

Text Mined References (11)

PMID Year Title