Property Summary

NCBI Gene PubMed Count 9
Grant Count 15
R01 Count 11
Funding $1,693,260.66
PubMed Score 10.15
PubTator Score 9.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -3.384 0.000
medulloblastoma, large-cell -1.800 0.000
tuberculosis and treatment for 6 months 1.400 0.001
acute myeloid leukemia 1.200 0.012
ovarian cancer 1.500 0.000

Gene RIF (3)

PMID Text
26096974 WHAMM directs the Arp2/3 complex to the endoplasmic reticulum for autophagosome biogenesis through an actin comet tail mechanism.
23087206 Data show that RhoD binds the actin nucleation-promoting factor WHAMM (WASp homologue associated with actin Golgi membranes and microtubules), as well as the related filamin A-binding protein FILIP1.
23027905 results give rise to a model whereby distinct MT-bound and actin-nucleating populations of WHAMM collaborate during membrane tubulation

AA Sequence

MEDEQPDSLEGWVPVREGLFAEPERHRLRFLVAWNGAEGKFAVTCHDRTAQQRRLREGARLGPEPEPKPE      1 - 70
AAVSPSSWAGLLSAAGLRGAHRQLAALWPPLERCFPRLPPELDVGGGGAWGLGLGLWALLWPTRAGPGEA     71 - 140
ALQELCGQLERYLGAAADGCGGATVRDALFPAEGGAADCESPREFRERALRARWVEADARLRQVIQGHGK    141 - 210
ANTMVALMNVYQEEDEAYQELVTVATMFFQYLLQPFRAMREVATLCKLDILKSLDEDDLGPRRVVALEKE    211 - 280
AEEWTRRAEEAVVSIQDITVNYFKETVKALAGMQKEMEQDAKRFGQAAWATAIPRLEKLQLMLARETLQL    281 - 350
MRAKELCLNHKRAEIQGKMEDLPEQEKNTNVVDELEIQFYEIQLELYEVKFEILKNEEILLTTQLDSLKR    351 - 420
LIKEKQDEVVYYDPCENPEELKVIDCVVGLQDDKNLEVKELRRQCQQLESKRGRICAKRASLRSRKDQCK    421 - 490
ENHRFRLQQAEESIRYSRQHHSIQMKRDKIKEEEQKKKEWINQERQKTLQRLRSFKDKRLAQSVRNTSGS    491 - 560
EPVAPNLPSDLSQQMCLPASHAVSVIHPSSRKTRGVPLSEAGNVKSPKCQNCHGNIPVQVFVPVGDQTHS    561 - 630
KSSEELSLPPPPPPPPPPPPPPPPPPPPLRALSSSSQAATHQNLGFRAPVKDDQPRPLVCESPAERPRDS    631 - 700
LESFSCPGSMDEVLASLRHGRAPLRKVEVPAVRPPHASINEHILAAIRQGVKLKKVHPDLGPNPSSKPTS    701 - 770
NRRTSDLERSIKAALQRIKRVSADSEEDSDEQDPGQWDG                                   771 - 809
//

Text Mined References (11)

PMID Year Title
26096974 2015 WHAMM Directs the Arp2/3 Complex to the ER for Autophagosome Biogenesis through an Actin Comet Tail Mechanism.
23087206 2012 RhoD regulates cytoskeletal dynamics via the actin nucleation-promoting factor WASp homologue associated with actin Golgi membranes and microtubules.
23027905 2012 Structural insights into WHAMM-mediated cytoskeletal coordination during membrane remodeling.
18812086 2008 Cytoskeletal regulation: coordinating actin and microtubule dynamics in membrane trafficking.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18614018 2008 WHAMM is an Arp2/3 complex activator that binds microtubules and functions in ER to Golgi transport.
18226259 2008 Genomic analysis of the chromosome 15q11-q13 Prader-Willi syndrome region and characterization of transcripts for GOLGA8E and WHCD1L1 from the proximal breakpoint region.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...