Property Summary

NCBI Gene PubMed Count 9
PubMed Score 10.15
PubTator Score 9.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 7.9124820955557E-11
medulloblastoma, large-cell 6234 1.56203656352174E-5
ovarian cancer 8492 9.80090125775871E-5
tuberculosis and treatment for 6 months 686 9.41022737633298E-4
acute myeloid leukemia 785 0.0123130578945097
Disease Target Count Z-score Confidence
Wiskott-Aldrich syndrome 27 3.783 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -3.384 0.000
medulloblastoma, large-cell -1.800 0.000
tuberculosis and treatment for 6 months 1.400 0.001
acute myeloid leukemia 1.200 0.012
ovarian cancer 1.500 0.000

Synonym

Accession Q8TF30 Q8N1J9
Symbols WHDC1
WHAMM1

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG

Gene RIF (3)

PMID Text
26096974 WHAMM directs the Arp2/3 complex to the endoplasmic reticulum for autophagosome biogenesis through an actin comet tail mechanism.
23087206 Data show that RhoD binds the actin nucleation-promoting factor WHAMM (WASp homologue associated with actin Golgi membranes and microtubules), as well as the related filamin A-binding protein FILIP1.
23027905 results give rise to a model whereby distinct MT-bound and actin-nucleating populations of WHAMM collaborate during membrane tubulation

AA Sequence

MEDEQPDSLEGWVPVREGLFAEPERHRLRFLVAWNGAEGKFAVTCHDRTAQQRRLREGARLGPEPEPKPE      1 - 70
AAVSPSSWAGLLSAAGLRGAHRQLAALWPPLERCFPRLPPELDVGGGGAWGLGLGLWALLWPTRAGPGEA     71 - 140
ALQELCGQLERYLGAAADGCGGATVRDALFPAEGGAADCESPREFRERALRARWVEADARLRQVIQGHGK    141 - 210
ANTMVALMNVYQEEDEAYQELVTVATMFFQYLLQPFRAMREVATLCKLDILKSLDEDDLGPRRVVALEKE    211 - 280
AEEWTRRAEEAVVSIQDITVNYFKETVKALAGMQKEMEQDAKRFGQAAWATAIPRLEKLQLMLARETLQL    281 - 350
MRAKELCLNHKRAEIQGKMEDLPEQEKNTNVVDELEIQFYEIQLELYEVKFEILKNEEILLTTQLDSLKR    351 - 420
LIKEKQDEVVYYDPCENPEELKVIDCVVGLQDDKNLEVKELRRQCQQLESKRGRICAKRASLRSRKDQCK    421 - 490
ENHRFRLQQAEESIRYSRQHHSIQMKRDKIKEEEQKKKEWINQERQKTLQRLRSFKDKRLAQSVRNTSGS    491 - 560
EPVAPNLPSDLSQQMCLPASHAVSVIHPSSRKTRGVPLSEAGNVKSPKCQNCHGNIPVQVFVPVGDQTHS    561 - 630
KSSEELSLPPPPPPPPPPPPPPPPPPPPLRALSSSSQAATHQNLGFRAPVKDDQPRPLVCESPAERPRDS    631 - 700
LESFSCPGSMDEVLASLRHGRAPLRKVEVPAVRPPHASINEHILAAIRQGVKLKKVHPDLGPNPSSKPTS    701 - 770
NRRTSDLERSIKAALQRIKRVSADSEEDSDEQDPGQWDG                                   771 - 809
//

Text Mined References (11)

PMID Year Title
26096974 2015 WHAMM Directs the Arp2/3 Complex to the ER for Autophagosome Biogenesis through an Actin Comet Tail Mechanism.
23087206 2012 RhoD regulates cytoskeletal dynamics via the actin nucleation-promoting factor WASp homologue associated with actin Golgi membranes and microtubules.
23027905 2012 Structural insights into WHAMM-mediated cytoskeletal coordination during membrane remodeling.
18812086 2008 Cytoskeletal regulation: coordinating actin and microtubule dynamics in membrane trafficking.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18614018 2008 WHAMM is an Arp2/3 complex activator that binds microtubules and functions in ER to Golgi transport.
18226259 2008 Genomic analysis of the chromosome 15q11-q13 Prader-Willi syndrome region and characterization of transcripts for GOLGA8E and WHCD1L1 from the proximal breakpoint region.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...