Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.31
PubTator Score 2.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
posterior fossa group B ependymoma 4.600 0.000
group 3 medulloblastoma -1.500 0.004
glioblastoma -1.100 0.028
medulloblastoma, large-cell -2.300 0.000
non-small cell lung cancer -1.328 0.000
pediatric high grade glioma -1.100 0.020
lung adenocarcinoma -1.200 0.003
nasopharyngeal carcinoma -3.400 0.000
Endometriosis -1.278 0.032
ductal carcinoma in situ 1.200 0.035
ovarian cancer -1.300 0.003
Breast cancer -1.200 0.000

Synonym

Accession Q8TF09
Symbols DNCL2B
DNLC2B
ROBLD2

Gene

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19844255 Observational study of gene-disease association. (HuGE Navigator)
19711352 Findings indicate that km23-2 (DYNLRB2) is required for Smad3-dependent TGFbeta signaling. Km23-2 has functions in TGFbeta signaling that are distinct from those for km23-1 (DYNLRB1).
11750132 Among the total 68 liver cancer samples tested, DNLC2B was down-regulated in 28 cases.

AA Sequence

MAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLR      1 - 70
IRSKKHEIMVAPDKEYLLIVIQNPCE                                                 71 - 96
//

Text Mined References (11)

PMID Year Title
23509613 2013 Genome-wide association study of antiphospholipid antibodies.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
19711352 2009 Requirement of a dynein light chain in TGFbeta/Smad3 signaling.
16260502 2005 Cytoplasmic dynein nomenclature.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12077152 2002 The roadblock light chain binds a novel region of the cytoplasmic Dynein intermediate chain.
More...