Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.59
PubTator Score 2.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer -1.200 7.4e-07
ductal carcinoma in situ 1.200 3.5e-02
Endometriosis -1.278 3.2e-02
ependymoma 3.100 7.0e-09
glioblastoma -1.100 2.8e-02
group 3 medulloblastoma -1.500 4.5e-03
lung adenocarcinoma -1.200 3.5e-03
medulloblastoma, large-cell -2.300 6.4e-06
nasopharyngeal carcinoma -3.400 2.7e-07
non-small cell lung cancer -1.328 2.9e-05
ovarian cancer -1.300 3.3e-03
pediatric high grade glioma -1.100 2.0e-02

Gene RIF (4)

AA Sequence

MAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLR      1 - 70
IRSKKHEIMVAPDKEYLLIVIQNPCE                                                 71 - 96
//

Text Mined References (11)

PMID Year Title