Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.86
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Gene RIF (3)

AA Sequence

MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQIGIEWNLSPV      1 - 70
GRVTPKEWKHQ                                                                71 - 81
//

Text Mined References (7)

PMID Year Title