Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.86
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Synonym

Accession Q8TF08 Q32Q40
Symbols

Gene

Gene RIF (3)

PMID Text
22419111 Tat-induced mitochondrial membrane permeabilization is associated with inhibition of cytochrome c oxidase (COX) activity by Tat in disrupted mitochondria from human samples
19064571 Observational study of gene-disease association. (HuGE Navigator)
15623157 codon 26 of COX7B2 gene might be evolutionarily conserved and the rare variation His26Gln may be associated with a high risk of nasopharyngeal carcinoma

AA Sequence

MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQIGIEWNLSPV      1 - 70
GRVTPKEWKHQ                                                                71 - 81
//

Text Mined References (7)

PMID Year Title
23937595 2013 A genome-wide search for type 2 diabetes susceptibility genes in an extended Arab family.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15623157 2004 A rare polymorphism of the COX7B2 gene in a Cantonese family with nasopharyngeal carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.