Property Summary

NCBI Gene PubMed Count 17
PubMed Score 5.42
PubTator Score 5.63

Knowledge Summary


No data available



  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 3.0e-06
ependymoma 1.400 3.6e-02
glioblastoma 1.500 2.0e-03
group 3 medulloblastoma 1.500 1.5e-04
juvenile dermatomyositis 1.117 1.1e-12
Multiple myeloma 1.291 4.6e-03
oligodendroglioma 1.300 2.8e-02
ovarian cancer -1.600 4.1e-05
primitive neuroectodermal tumor 1.300 1.6e-04
psoriasis 1.600 7.1e-05

Gene RIF (3)

AA Sequence

EQTIMALQMDRDSDVKYFASIHPASTKISEDAMSTASSTY                                  911 - 950

Text Mined References (20)

PMID Year Title