Property Summary

NCBI Gene PubMed Count 17
PubMed Score 5.42
PubTator Score 5.63

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 3.0e-06
ependymoma 1.400 3.6e-02
glioblastoma 1.500 2.0e-03
group 3 medulloblastoma 1.500 1.5e-04
juvenile dermatomyositis 1.117 1.1e-12
Multiple myeloma 1.291 4.6e-03
oligodendroglioma 1.300 2.8e-02
ovarian cancer -1.600 4.1e-05
primitive neuroectodermal tumor 1.300 1.6e-04
psoriasis 1.600 7.1e-05

Synonym

Accession Q8TF05 Q99774 Q9UNQ7
Symbols MEG1
PP4R1
PP4(Rmeg)

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MADLSLLQEDLQEDADGFGVDDYSSESDVIIIPSALDFVSQDEMLTPLGRLDKYAASENIFNRQMVARSL      1 - 70
LDTLREVCDDERDCIAVLERISRLADDSEPTVRAELMEQVPHIALFCQENRPSIPYAFSKFLLPIVVRYL     71 - 140
ADQNNQVRKTSQAALLALLEQELIERFDVETKVCPVLIELTAPDSNDDVKTEAVAIMCKMAPMVGKDITE    141 - 210
RLILPRFCEMCCDCRMFHVRKVCAANFGDICSVVGQQATEEMLLPRFFQLCSDNVWGVRKACAECFMAVS    211 - 280
CATCQEIRRTKLSALFINLISDPSRWVRQAAFQSLGPFISTFANPSSSGQYFKEESKSSEEMSVENKNRT    281 - 350
RDQEAPEDVQVRPEDTPSDLSVSNSSVILENTMEDHAAEASGKPLGEISVPLDSSLLCTLSSESHQEAAS    351 - 420
NENDKKPGNYKSMLRPEVGTTSQDSALLDQELYNSFHFWRTPLPEIDLDIELEQNSGGKPSPEGPEEESE    421 - 490
GPVPSSPNITMATRKELEEMIENLEPHIDDPDVKAQVEVLSAALRASSLDAHEETISIEKRSDLQDELDI    491 - 560
NELPNCKINQEDSVPLISDAVENMDSTLHYIHSDSDLSNNSSFSPDEERRTKVQDVVPQALLDQYLSMTD    561 - 630
PSRAQTVDTEIAKHCAYSLPGVALTLGRQNWHCLRETYETLASDMQWKVRRTLAFSIHELAVILGDQLTA    631 - 700
ADLVPIFNGFLKDLDEVRIGVLKHLHDFLKLLHIDKRREYLYQLQEFLVTDNSRNWRFRAELAEQLILLL    701 - 770
ELYSPRDVYDYLRPIALNLCADKVSSVRWISYKLVSEMVKKLHAATPPTFGVDLINELVENFGRCPKWSG    771 - 840
RQAFVFVCQTVIEDDCLPMDQFAVHLMPHLLTLANDRVPNVRVLLAKTLRQTLLEKDYFLASASCHQEAV    841 - 910
EQTIMALQMDRDSDVKYFASIHPASTKISEDAMSTASSTY                                  911 - 950
//

Text Mined References (20)

PMID Year Title