Property Summary

NCBI Gene PubMed Count 26
Grant Count 10
R01 Count 7
Funding $1,508,785.96
PubMed Score 12.74
PubTator Score 20.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.900 0.000
osteosarcoma 1.369 0.000
juvenile dermatomyositis 1.325 0.000
acute quadriplegic myopathy 1.454 0.000
intraductal papillary-mucinous neoplasm ... 1.500 0.028
Pick disease 1.300 0.000
ovarian cancer -1.800 0.000
dermatomyositis 1.200 0.001

Gene RIF (14)

PMID Text
26304236 Data show thata combining cyclin-dependent kinase 2 (CDK2) antagonism and ubiquitin thioesterase 33 (USP33) depletion augments anaphase catastrophe via changes in centrosomal protein of 110 kDa (CP110) protein expression.
25242263 USP33 as a previously unknown tumor-suppressing gene.
24981056 Data show that ubiquitin specific peptidase 33 (USP33) mediates nerve tissue proteins Slit-Robo signaling in lung cancer cell migration.
24855649 Knockdown or chemical inhibition of p97 causes robust accumulation of USP33 due to inhibition of its degradation
24056301 nutrient starvation induces RALB deubiquitylation by accumulation and relocalization of the deubiquitylase USP33 to RALB-positive vesicles
23486064 using human cells, identification of a new mechanism for the regulation of centrosome duplication that requires USP33, a deubiquitinating enzyme that is able to regulate CP110 levels
20724312 Meta-analysis of gene-disease association. (HuGE Navigator)
19706539 Data uncover a previously unknown function of USP33 and reveal a new player in Slit-Robo signaling in cancer cell migration.
19684588 Our results reveal a previously unknown role for USP33 in vertebrate commissural axon guidance and in Slit signaling
19424180 USPs 20 and 33 serve as novel regulators that dictate both post-endocytic sorting as well as the intensity and extent of beta(2)AR signalling from the cell surface.
More...

AA Sequence

MTGSNSHITILTLKVLPHFESLGKQEKIPNKMSAFRNHCPHLDSVGEITKEDLIQKSLGTCQDCKVQGPN      1 - 70
LWACLENRCSYVGCGESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQPSLPHVRQPH     71 - 140
QIQENSVQDFKIPSNTTLKTPLVAVFDDLDIEADEEDELRARGLTGLKNIGNTCYMNAALQALSNCPPLT    141 - 210
QFFLDCGGLARTDKKPAICKSYLKLMTELWHKSRPGSVVPTTLFQGIKTVNPTFRGYSQQDAQEFLRCLM    211 - 280
DLLHEELKEQVMEVEEDPQTITTEETMEEDKSQSDVDFQSCESCSNSDRAENENGSRCFSEDNNETTMLI    281 - 350
QDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETVKVQIHSRASEYITDVHSNDL    351 - 420
STPQILPSNEGVNPRLSASPPKSGNLWPGLAPPHKKAQSASPKRKKQHKKYRSVISDIFDGTIISSVQCL    421 - 490
TCDRVSVTLETFQDLSLPIPGKEDLAKLHSSSHPTSIVKAGSCGEAYAPQGWIAFFMEYVKRFVVSCVPS    491 - 560
WFWGPVVTLQDCLAAFFARDELKGDNMYSCEKCKKLRNGVKFCKVQNFPEILCIHLKRFRHELMFSTKIS    561 - 630
THVSFPLEGLDLQPFLAKDSPAQIVTYDLLSVICHHGTASSGHYIAYCRNNLNNLWYEFDDQSVTEVSES    631 - 700
TVQNAEAYVLFYRKSSEEAQKERRRISNLLNIMEPSLLQFYISRQWLNKFKTFAEPGPISNNDFLCIHGG    701 - 770
VPPRKAGYIEDLVLMLPQNIWDNLYSRYGGGPAVNHLYICHTCQIEAEKIEKRRKTELEIFIRLNRAFQK    771 - 840
EDSPATFYCISMQWFREWESFVKGKDGDPPGPIDNTKIAVTKCGNVMLRQGADSGQISEETWNFLQSIYG    841 - 910
GGPEVILRPPVVHVDPDILQAEEKIEVETRSL                                          911 - 942
//

Text Mined References (29)

PMID Year Title
26304236 2015 Specific CP110 Phosphorylation Sites Mediate Anaphase Catastrophe after CDK2 Inhibition: Evidence for Cooperation with USP33 Knockdown.
25242263 2015 USP33 mediates Slit-Robo signaling in inhibiting colorectal cancer cell migration.
24981056 2014 USP33, a new player in lung cancer, mediates Slit-Robo signaling.
24855649 2014 Degradation of the deubiquitinating enzyme USP33 is mediated by p97 and the ubiquitin ligase HERC2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24056301 2013 The deubiquitylase USP33 discriminates between RALB functions in autophagy and innate immune response.
23486064 2013 USP33 regulates centrosome biogenesis via deubiquitination of the centriolar protein CP110.
21801292 2011 Isoform-specific localization of the deubiquitinase USP33 to the Golgi apparatus.
20724312 2011 Meta-analyses of genes modulating intracellular T3 bio-availability reveal a possible role for the DIO3 gene in osteoarthritis susceptibility.
19832994 2009 Identification of novel androgen-responsive genes by sequencing of LongSAGE libraries.
More...