Property Summary

NCBI Gene PubMed Count 27
PubMed Score 13.02
PubTator Score 20.32

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy 1.454 1.6e-05
dermatomyositis 1.200 7.1e-04
intraductal papillary-mucinous neoplasm ... 1.500 2.8e-02
juvenile dermatomyositis 1.325 1.1e-10
osteosarcoma 1.369 1.2e-05
ovarian cancer -1.800 1.1e-05
Pick disease 1.300 1.4e-05
psoriasis -1.900 1.1e-04

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (15)

AA Sequence

MTGSNSHITILTLKVLPHFESLGKQEKIPNKMSAFRNHCPHLDSVGEITKEDLIQKSLGTCQDCKVQGPN      1 - 70
LWACLENRCSYVGCGESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQPSLPHVRQPH     71 - 140
QIQENSVQDFKIPSNTTLKTPLVAVFDDLDIEADEEDELRARGLTGLKNIGNTCYMNAALQALSNCPPLT    141 - 210
QFFLDCGGLARTDKKPAICKSYLKLMTELWHKSRPGSVVPTTLFQGIKTVNPTFRGYSQQDAQEFLRCLM    211 - 280
DLLHEELKEQVMEVEEDPQTITTEETMEEDKSQSDVDFQSCESCSNSDRAENENGSRCFSEDNNETTMLI    281 - 350
QDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETVKVQIHSRASEYITDVHSNDL    351 - 420
STPQILPSNEGVNPRLSASPPKSGNLWPGLAPPHKKAQSASPKRKKQHKKYRSVISDIFDGTIISSVQCL    421 - 490
TCDRVSVTLETFQDLSLPIPGKEDLAKLHSSSHPTSIVKAGSCGEAYAPQGWIAFFMEYVKRFVVSCVPS    491 - 560
WFWGPVVTLQDCLAAFFARDELKGDNMYSCEKCKKLRNGVKFCKVQNFPEILCIHLKRFRHELMFSTKIS    561 - 630
THVSFPLEGLDLQPFLAKDSPAQIVTYDLLSVICHHGTASSGHYIAYCRNNLNNLWYEFDDQSVTEVSES    631 - 700
TVQNAEAYVLFYRKSSEEAQKERRRISNLLNIMEPSLLQFYISRQWLNKFKTFAEPGPISNNDFLCIHGG    701 - 770
VPPRKAGYIEDLVLMLPQNIWDNLYSRYGGGPAVNHLYICHTCQIEAEKIEKRRKTELEIFIRLNRAFQK    771 - 840
EDSPATFYCISMQWFREWESFVKGKDGDPPGPIDNTKIAVTKCGNVMLRQGADSGQISEETWNFLQSIYG    841 - 910
GGPEVILRPPVVHVDPDILQAEEKIEVETRSL                                          911 - 942
//

Text Mined References (30)

PMID Year Title