Property Summary

NCBI Gene PubMed Count 10
PubMed Score 47.58
PubTator Score 14.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene RIF (4)

AA Sequence

MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGLQESEPEDFLK      1 - 70
LFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSPMLYEVVYEAGALERMQGETGPNVGLISIQL     71 - 140
DQWSPAFMVPDSCMVSELPFDAHAHILPRAGTVAPVPCTTLLPCQTLFLTDEEKRLLGQEGVSLPSHLPL    141 - 210
TKAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACSAQNQELQKKVQELERHNISLVAQLRQL    211 - 280
QTLIAQTSNKAAQTSTCVLILLFSLALIILPSFSPFQSRPEAGSEDYQPHGVTSRNILTHKDVTENLETQ    281 - 350
VVESRLREPPGAKDANGSTRTLLEKMGGKPRPSGRIRSVLHADEM                             351 - 395
//

Text Mined References (15)

PMID Year Title