Property Summary

NCBI Gene PubMed Count 10
PubMed Score 44.29
PubTator Score 14.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 4.70203075190411E-7
group 3 medulloblastoma 2254 2.99357358942879E-6
atypical teratoid / rhabdoid tumor 4369 1.19196739174171E-4
glioblastoma 5572 1.45186140807511E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.10794670728194E-4
medulloblastoma, large-cell 6234 3.557158068427E-4
primitive neuroectodermal tumor 3031 4.82519460126454E-4
ductal carcinoma in situ 1745 6.61081854980686E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 9.96388969297947E-4
osteosarcoma 7933 0.0042868268553235
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00545910285115091
invasive ductal carcinoma 2950 0.00660790362522623
breast carcinoma 1614 0.00790173847386188
fibroadenoma 557 0.0127306813584808
oligodendroglioma 2849 0.0279897714502165
primary Sjogren syndrome 789 0.0400818308813193

Expression

Gene RIF (4)

PMID Text
17712038 In LNCaP cell lines that conditionally express the processed form of AIbZIP, downstream targets of AIbZIP include genes for protein processing, transcriptional regulation, small molecule transport, signal transduction, metabolism & cell homeostasis.
16236796 S1P cleavage of CREB4 may be suppressed by a determinant in the C-terminal region
12111373 identified a novel human CREB gene (CREB4) that was 1592 bp long and encoded a protein of 395 amino acid residues
11830526 AIbZIP, a novel bZIP gene located on chromosome 1q21.3 that is highly expressed in prostate tumors and of which the expression is up-regulated by androgens in LNCaP human prostate cancer cells.

AA Sequence

MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGLQESEPEDFLK      1 - 70
LFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSPMLYEVVYEAGALERMQGETGPNVGLISIQL     71 - 140
DQWSPAFMVPDSCMVSELPFDAHAHILPRAGTVAPVPCTTLLPCQTLFLTDEEKRLLGQEGVSLPSHLPL    141 - 210
TKAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACSAQNQELQKKVQELERHNISLVAQLRQL    211 - 280
QTLIAQTSNKAAQTSTCVLILLFSLALIILPSFSPFQSRPEAGSEDYQPHGVTSRNILTHKDVTENLETQ    281 - 350
VVESRLREPPGAKDANGSTRTLLEKMGGKPRPSGRIRSVLHADEM                             351 - 395
//

Text Mined References (15)

PMID Year Title
22903471 2013 Genome-wide association identifies genetic variants associated with lentiform nucleus volume in N?=?1345 young and elderly subjects.
18068530 2008 CREB3L4, INTS3, and SNAPAP are targets for the 1q21 amplicon frequently detected in hepatocellular carcinoma.
17933519 2008 Androgen-regulated transcription factor AIbZIP in prostate cancer.
17712038 2007 Transcriptional profiling of genes that are regulated by the endoplasmic reticulum-bound transcription factor AIbZIP/CREB3L4 in prostate cells.
17270658 2007 Evaluation of AIbZIP and Cdc47 as markers for human prostatic diseases.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16236796 2006 CREB4, a transmembrane bZip transcription factor and potential new substrate for regulation and cleavage by S1P.
15938716 2005 Tisp40, a spermatid specific bZip transcription factor, functions by binding to the unfolded protein response element via the Rip pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...