Property Summary

NCBI Gene PubMed Count 15
PubMed Score 8.13
PubTator Score 6.15

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count Z-score Confidence
Hairy Cell Leukemia 6 3.96 2.0




PANTHER Protein Class (1)

  Ortholog (11)

Pathway (1)

Gene RIF (4)

22190034 HIV-1 IN is identified to have a physical interaction with importin 4 (IPO4) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20805509 report a function of IPO4 and nuclear import in the Fanconi anemia pathway of DNA repair
19788888 importins 4 and 7 accomplish nuclear import of HIF-1alpha more efficiently than the classical importin alpha/beta NLS receptor.
16207705 demonstrated that vitamin D receptor (VDR) has two nuclear import systems: ligand-dependent & ligand-independent pathways, & that importin 4 fulfills the ligand-independent nuclear transport through the interaction with the amino terminus of VDR

AA Sequence

LAKQHTDSFQAALGSLPVDKAQELQAVLGLS                                          1051 - 1081

Text Mined References (21)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22407294 2012 Codanin-1, mutated in the anaemic disease CDAI, regulates Asf1 function in S-phase histone supply.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22022502 2011 An interaction network predicted from public data as a discovery tool: application to the Hsp90 molecular chaperone machine.
21269460 2011 Initial characterization of the human central proteome.
20805509 2010 CCAAT/enhancer binding protein delta (C/EBPdelta, CEBPD)-mediated nuclear import of FANCD2 by IPO4 augments cellular response to DNA damage.
19946888 2010 Defining the membrane proteome of NK cells.
19788888 2009 Transport of hypoxia-inducible factor HIF-1alpha into the nucleus involves importins 4 and 7.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17616579 2007 Cellular cofactors affecting hepatitis C virus infection and replication.