Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7.22
PubTator Score 8.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytoma 1.200 7.6e-16
atypical teratoid / rhabdoid tumor 1.700 1.3e-06
breast carcinoma -1.200 1.0e-05
ductal carcinoma in situ -1.100 2.0e-03
ependymoma 1.300 8.9e-03
invasive ductal carcinoma -1.500 5.0e-03
lung carcinoma -1.400 1.1e-28
non primary Sjogren syndrome sicca -1.200 2.5e-02
non-small cell lung cancer -1.397 9.2e-18
oligodendroglioma 1.100 4.6e-11
ovarian cancer -1.900 3.8e-11
pancreatic cancer 1.100 1.8e-02
Pick disease 1.300 1.2e-02
primary pancreatic ductal adenocarcinoma 1.043 1.0e-02
primitive neuroectodermal tumor 1.100 4.0e-02
ulcerative colitis -1.100 7.9e-06

Gene RIF (8)

AA Sequence

MKVTVCFGRTGIVVPCKEGQLRVGELTQQALQRYLKTREKGPGYWVKIHHLEYTDGGILDPDDVLADVVE      1 - 70
DKDKLIAVFEEQEPLHKIESPSGNPADRQSPDAFETEVAAQLAAFKPIGGEIEVTPSALKLGTPLLVRRS     71 - 140
SDPVPGPPADTQPSASHPGGQSLKLVVPDSTQNLEDREVLNGVQTELLTSPRTKDTLSDMTRTVEISGEG    141 - 210
GPLGIHVVPFFSSLSGRILGLFIRGIEDNSRSKREGLFHENECIVKINNVDLVDKTFAQAQDVFRQAMKS    211 - 280
PSVLLHVLPPQNREQYEKSVIGSLNIFGNNDGVLKTKVPPPVHGKSGLKTANLTGTDSPETDASASLQQN    281 - 350
KSPRVPRLGGKPSSPSLSPLMGFGSNKNAKKIKIDLKKGPEGLGFTVVTRDSSIHGPGPIFVKNILPKGA    351 - 420
AIKDGRLQSGDRILEVNGRDVTGRTQEELVAMLRSTKQGETASLVIARQEGHFLPRELKGEPDCCALSLE    421 - 490
TSEQLTFEIPLNDSGSAGLGVSLKGNKSRETGTDLGIFIKSIIHGGAAFKDGRLRMNDQLIAVNGESLLG    491 - 560
KSNHEAMETLRRSMSMEGNIRGMIQLVILRRPERPMEDPAECGAFSKPCFENCQNAVTTSRRNDNSILHP    561 - 630
LGTCSPQDKQKGLLLPNDGWAESEVPPSPTPHSALGLGLEDYSHSSGVDSAVYFPDQHINFRSVTPARQP    631 - 700
ESINLKASKSMDLVPDESKVHSLAGQKSESPSKDFGPTLGLKKSSSLESLQTAVAEVRKNDLPFHRPRPH    701 - 770
MVRGRGCNESFRAAIDKSYDGPEEIEADGLSDKSSHSGQGALNCESAPQGNSELEDMENKARKVKKTKEK    771 - 840
EKKKEKGKLKVKEKKRKEENEDPERKIKKKGFGAMLRFGKKKEDKGGKAEQKGTLKHGGLREEELEKMKE    841 - 910
ERERIGAKHQELREKQARGLLDYATGAIGSVYDMDDDEMDPNYARVNHFREPCTSANVFRSPSPPRAGPF    911 - 980
GYPRDGHPLSPERDHLEGLYAKVNKPYHPLVPADSGRPTGGSTDRIQKLRKEYYQARREGFPLYEDDEGR    981 - 1050
ARPSEYDLLWVPGRGPDGNAHNLRFEGMERQYASLPRGGPADPVDYLPAAPRGLYKERELPYYPGAHPMH   1051 - 1120
PPKGSYPRPTELRVADLRYPQHYPPPPAPQHKGPFRQDVPPSPPQHQRMPAYQETGRPGPRGGSPDQYPY   1121 - 1190
RTQDSRQKNPMTAAV                                                          1191 - 1205
//

Text Mined References (22)

PMID Year Title