Property Summary

NCBI Gene PubMed Count 16
Grant Count 4
R01 Count 4
Funding $347,556
PubMed Score 7.23
PubTator Score 8.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Synonym

Accession Q8TEW8 E9PE87 Q8IUC7 Q8IUC9 Q96DK9 Q96N09 Q96NX6 Q96NX7 Q96Q29
Symbols PAR3B
PAR3L
ALS2CR19
PAR3beta

Gene

Gene RIF (6)

PMID Text
21502085 The association of single-nucleotide polymorphisms of PARD3B with slower progression of HIV infection to AIDS is reported.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20670164 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15721295 binding of 14-3-3 to Par3beta is dependent on phosphorylation
12459187 PAR3beta, expressed intrinsically or extrinsically, localizes to the tight junctions, indicating that the localization does not require the ternary complex formation.

AA Sequence

MKVTVCFGRTGIVVPCKEGQLRVGELTQQALQRYLKTREKGPGYWVKIHHLEYTDGGILDPDDVLADVVE      1 - 70
DKDKLIAVFEEQEPLHKIESPSGNPADRQSPDAFETEVAAQLAAFKPIGGEIEVTPSALKLGTPLLVRRS     71 - 140
SDPVPGPPADTQPSASHPGGQSLKLVVPDSTQNLEDREVLNGVQTELLTSPRTKDTLSDMTRTVEISGEG    141 - 210
GPLGIHVVPFFSSLSGRILGLFIRGIEDNSRSKREGLFHENECIVKINNVDLVDKTFAQAQDVFRQAMKS    211 - 280
PSVLLHVLPPQNREQYEKSVIGSLNIFGNNDGVLKTKVPPPVHGKSGLKTANLTGTDSPETDASASLQQN    281 - 350
KSPRVPRLGGKPSSPSLSPLMGFGSNKNAKKIKIDLKKGPEGLGFTVVTRDSSIHGPGPIFVKNILPKGA    351 - 420
AIKDGRLQSGDRILEVNGRDVTGRTQEELVAMLRSTKQGETASLVIARQEGHFLPRELKGEPDCCALSLE    421 - 490
TSEQLTFEIPLNDSGSAGLGVSLKGNKSRETGTDLGIFIKSIIHGGAAFKDGRLRMNDQLIAVNGESLLG    491 - 560
KSNHEAMETLRRSMSMEGNIRGMIQLVILRRPERPMEDPAECGAFSKPCFENCQNAVTTSRRNDNSILHP    561 - 630
LGTCSPQDKQKGLLLPNDGWAESEVPPSPTPHSALGLGLEDYSHSSGVDSAVYFPDQHINFRSVTPARQP    631 - 700
ESINLKASKSMDLVPDESKVHSLAGQKSESPSKDFGPTLGLKKSSSLESLQTAVAEVRKNDLPFHRPRPH    701 - 770
MVRGRGCNESFRAAIDKSYDGPEEIEADGLSDKSSHSGQGALNCESAPQGNSELEDMENKARKVKKTKEK    771 - 840
EKKKEKGKLKVKEKKRKEENEDPERKIKKKGFGAMLRFGKKKEDKGGKAEQKGTLKHGGLREEELEKMKE    841 - 910
ERERIGAKHQELREKQARGLLDYATGAIGSVYDMDDDEMDPNYARVNHFREPCTSANVFRSPSPPRAGPF    911 - 980
GYPRDGHPLSPERDHLEGLYAKVNKPYHPLVPADSGRPTGGSTDRIQKLRKEYYQARREGFPLYEDDEGR    981 - 1050
ARPSEYDLLWVPGRGPDGNAHNLRFEGMERQYASLPRGGPADPVDYLPAAPRGLYKERELPYYPGAHPMH   1051 - 1120
PPKGSYPRPTELRVADLRYPQHYPPPPAPQHKGPFRQDVPPSPPQHQRMPAYQETGRPGPRGGSPDQYPY   1121 - 1190
RTQDSRQKNPMTAAV                                                          1191 - 1205
//

Text Mined References (20)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23527680 2013 Genome-wide association study of inattention and hyperactivity-impulsivity measured as quantitative traits.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22843504 2012 Individual common variants exert weak effects on the risk for autism spectrum disorders.
21502085 2011 Genome-wide association study implicates PARD3B-based AIDS restriction.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20694014 2010 Genome-wide association analyses identifies a susceptibility locus for tuberculosis on chromosome 18q11.2.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20670164 2010 Association of genetic polymorphisms with hepatotoxicity in patients with childhood acute lymphoblastic leukemia or lymphoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...