Property Summary

NCBI Gene PubMed Count 15
PubMed Score 17.67
PubTator Score 13.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (7)

AA Sequence

MATNFSDIVKQGYVKMKSRKLGIYRRCWLVFRKSSSKGPQRLEKYPDEKSVCLRGCPKVTEISNVKCVTR      1 - 70
LPKETKRQAVAIIFTDDSARTFTCDSELEAEEWYKTLSVECLGSRLNDISLGEPDLLAPGVQCEQTDRFN     71 - 140
VFLLPCPNLDVYGECKLQITHENIYLWDIHNPRVKLVSWPLCSLRRYGRDATRFTFEAGRMCDAGEGLYT    141 - 210
FQTQEGEQIYQRVHSATLAIAEQHKRVLLEMEKNVRLLNKGTEHYSYPCTPTTMLPRSAYWHHITGSQNI    211 - 280
AEASSYAGEGYGAAQASSETDLLNRFILLKPKPSQGDSSEAKTPSQ                            281 - 326
//

Text Mined References (15)

PMID Year Title