Property Summary

NCBI Gene PubMed Count 15
PubMed Score 17.67
PubTator Score 13.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Synonym

Accession Q8TEW6 O75209 Q9BTP2 Q9NVV3
Symbols IRS5
IRS-5

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

AA Sequence

MATNFSDIVKQGYVKMKSRKLGIYRRCWLVFRKSSSKGPQRLEKYPDEKSVCLRGCPKVTEISNVKCVTR      1 - 70
LPKETKRQAVAIIFTDDSARTFTCDSELEAEEWYKTLSVECLGSRLNDISLGEPDLLAPGVQCEQTDRFN     71 - 140
VFLLPCPNLDVYGECKLQITHENIYLWDIHNPRVKLVSWPLCSLRRYGRDATRFTFEAGRMCDAGEGLYT    141 - 210
FQTQEGEQIYQRVHSATLAIAEQHKRVLLEMEKNVRLLNKGTEHYSYPCTPTTMLPRSAYWHHITGSQNI    211 - 280
AEASSYAGEGYGAAQASSETDLLNRFILLKPKPSQGDSSEAKTPSQ                            281 - 326
//

Text Mined References (15)

PMID Year Title