Property Summary

NCBI Gene PubMed Count 15
Grant Count 1
R01 Count 1
Funding $59,516.75
PubMed Score 17.15
PubTator Score 13.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
22982678 the current study have explored in more detail the structure and function of the Dok-4 PTB domain.
19494292 Dok-4 represents a novel negative regulator of T cells
19073520 Epigenetic regulation of DOK4 expression is associated with non-small-cell lung cancer.
17443497 IRS-5 (DOK4) is significantly upregulated in 90% of examined clear cell RCCs. Studies on this gene has shown that it is regulated through chromatin remodeling in kidney cells
16820412 Results suggest that Dok-4, through activation of the Rap1-ERK1/2 pathway, regulates GDNF-mediated neurite outgrowth during neuronal development.
12730241 IRS5/DOK4 and IRS6/DOK5 represent two new signaling proteins with potential roles in insulin and IGF-1 action
12595900 DOK4 expression in human T cells has been demonstrated, and its genomic structure has been predicted.

AA Sequence

MATNFSDIVKQGYVKMKSRKLGIYRRCWLVFRKSSSKGPQRLEKYPDEKSVCLRGCPKVTEISNVKCVTR      1 - 70
LPKETKRQAVAIIFTDDSARTFTCDSELEAEEWYKTLSVECLGSRLNDISLGEPDLLAPGVQCEQTDRFN     71 - 140
VFLLPCPNLDVYGECKLQITHENIYLWDIHNPRVKLVSWPLCSLRRYGRDATRFTFEAGRMCDAGEGLYT    141 - 210
FQTQEGEQIYQRVHSATLAIAEQHKRVLLEMEKNVRLLNKGTEHYSYPCTPTTMLPRSAYWHHITGSQNI    211 - 280
AEASSYAGEGYGAAQASSETDLLNRFILLKPKPSQGDSSEAKTPSQ                            281 - 326
//

Text Mined References (15)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
23840749 2013 MOR is not enough: identification of novel mu-opioid receptor interacting proteins using traditional and modified membrane yeast two-hybrid screens.
22982678 2012 New insights into Dok-4 PTB domain structure and function.
19494292 2009 Dok-4 is a novel negative regulator of T cell activation.
19073520 2008 Transcriptional regulation of IRS5/DOK4 expression in non-small-cell lung cancer cells.
17443497 2007 DOK4/IRS-5 expression is altered in clear cell renal cell carcinoma.
16820412 2006 Dok-4 regulates GDNF-dependent neurite outgrowth through downstream activation of Rap1 and mitogen-activated protein kinase.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...