Property Summary

NCBI Gene PubMed Count 96
PubMed Score 220.10
PubTator Score 138.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytoma 1.500 1.0e-02
atypical teratoid / rhabdoid tumor 1.100 4.4e-04
Breast cancer -1.500 9.3e-13
breast carcinoma -1.200 1.7e-32
cutaneous lupus erythematosus -1.400 5.5e-03
glioblastoma 1.100 4.8e-05
group 3 medulloblastoma 1.100 1.6e-02
interstitial cystitis -1.200 3.4e-04
intraductal papillary-mucinous carcinoma... 1.200 5.5e-03
malignant mesothelioma 1.400 1.1e-06
non-small cell lung cancer 1.030 2.1e-09
osteosarcoma 1.365 8.7e-03
ovarian cancer -1.500 1.2e-06
pediatric high grade glioma 1.100 1.3e-03
Pick disease 1.200 6.3e-05
primitive neuroectodermal tumor 1.300 3.6e-03
psoriasis -1.300 2.4e-09
spina bifida -1.904 4.2e-02

Protein-protein Interaction (2)

Gene RIF (51)

AA Sequence

MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVAD      1 - 70
DKDRLVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFQPYQATSEIEVTPSVLRANMPLHV     71 - 140
RRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFLKQNTAGSPKTCDRKKDENYRSLPRDTSNWS    141 - 210
NQFQRDNARSSLSASHPMVGKWLEKQEQDEDGTEEDNSRVEPVGHADTGLEHIPNFSLDDMVKLVEVPND    211 - 280
GGPLGIHVVPFSARGGRTLGLLVKRLEKGGKAEHENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRT    281 - 350
PIIWFHVVPAANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQRAPRLNHPPEQIDSHSR    351 - 420
LPHSAHPSGKPPSAPASAPQNVFSTTVSSGYNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYV    421 - 490
KNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTVSLLVFRQEDAFHPRELNAEP    491 - 560
SQMQIPKETKAEDEDIVLTPDGTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAA    561 - 630
SKDGRLRVNDQLIAVNGESLLGKTNQDAMETLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPPGPE    631 - 700
LPIETALDDRERRISHSLYSGIEGLDESPSRNAALSRIMGESGKYQLSPTVNMPQDDTVIIEDDRLPVLP    701 - 770
PHLSDQSSSSSHDDVGFVTADAGTWAKAAISDSADCSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDAS    771 - 840
QLDFVKTRKSKSMDLGIADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEVTLNGDIPFHR    841 - 910
PRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMETLEEDTEESSRSGRESVSTASDQPSHSLERQMNG    911 - 980
NQEKGDKTDRKKDKTGKEKKKDRDKEKDKMKAKKGMLKGLGDMFRFGKHRKDDKIEKTGKIKIQESFTSE    981 - 1050
EERIRMKQEQERIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREG   1051 - 1120
HMMDALYAQVKKPRNSKPSPVDSNRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQPWPNARPAT   1121 - 1190
QSGRHSVSVEVQMQRQRQEERESSQQAQRQYSSLPRQSRKNASSVSQDSWEQNYSPGEGFQSAKENPRYS   1191 - 1260
SYQGSRNGYLGGHGFNARVMLETQELLRQEQRRKEQQMKKQPPSEGPSNYDSYKKVQDPSYAPPKGPFRQ   1261 - 1330
DVPPSPSQVARLNRLQTPEKGRPFYS                                               1331 - 1356
//

Text Mined References (108)

PMID Year Title