Property Summary

NCBI Gene PubMed Count 86
Grant Count 39
R01 Count 30
Funding $3,339,982.17
PubMed Score 196.08
PubTator Score 138.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
psoriasis -1.500 0.001
cutaneous lupus erythematosus -1.800 0.003
osteosarcoma 1.365 0.009
medulloblastoma 1.500 0.000
astrocytoma 1.500 0.010
atypical teratoid / rhabdoid tumor 1.500 0.000
glioblastoma 1.300 0.000
primitive neuroectodermal tumor 1.300 0.004
non-small cell lung cancer 1.123 0.000
intraductal papillary-mucinous carcinoma... 1.200 0.006
interstitial cystitis -1.500 0.000
pediatric high grade glioma 1.100 0.001
breast carcinoma -1.200 0.000
spina bifida -1.914 0.047
Pick disease 1.300 0.002
Breast cancer -1.500 0.000
ovarian cancer -1.500 0.000

Gene RIF (44)

PMID Text
26589794 Knockdown of the polarity protein Par3 reversed the effects of Galpha13 knockdown on cell-cell adhesion and proteolytic invasion in three-dimensional collagen.
26116754 study indicated a potential molecular basis for cell growth-promoting function of PARD3 by modulating the Hippo pathway signaling in response to cell contact and cell polarity signals
26050620 Shp2 promotes metastasis of prostate cancer by attenuating the PAR3/PAR6/aPKC polarity protein complex and enhancing epithelial-to-mesenchymal transition
25833829 PAR3-mutant proteins exhibit a relative reduction in the ability to mediate formation of tight junctions and actin-based protrusions and activate STAT3 at cell confluence.
25820151 Par-3 plays an important role in the modulation of intestinal barrier function by regulating delivery of occludin as well as suppression of MLC phosphorylation.
25518939 PAR3 and aPKC control the organization of the Golgi through CLASP2 phosphorylation.
24856572 A cytoplasmic expression of PAR-3 is therefore implicated in worse clinical and pathological cancer features in clear cell renal cell carcinoma and could be useful to identify patients with high-risk tumors.
24243103 The PAR polarity complex of PARD3, PARD6, and an atypical protein kinase C (aPKC) regulate several aspects of neuronal migration.[review]
24136590 Our results suggest that PAR-3 has a role in the clinical aggressiveness of cell Renal Cell Carcinoma
23322019 Data show that increased partitioning defective 3 (Par-3) expression is associated with distant metastasis and poor survival rates in patients with hepatocellular carcinoma (HCC).
More...

AA Sequence

MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILDLDDILCDVAD      1 - 70
DKDRLVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFQPYQATSEIEVTPSVLRANMPLHV     71 - 140
RRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFLKQNTAGSPKTCDRKKDENYRSLPRDTSNWS    141 - 210
NQFQRDNARSSLSASHPMVGKWLEKQEQDEDGTEEDNSRVEPVGHADTGLEHIPNFSLDDMVKLVEVPND    211 - 280
GGPLGIHVVPFSARGGRTLGLLVKRLEKGGKAEHENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRT    281 - 350
PIIWFHVVPAANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQRAPRLNHPPEQIDSHSR    351 - 420
LPHSAHPSGKPPSAPASAPQNVFSTTVSSGYNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYV    421 - 490
KNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTVSLLVFRQEDAFHPRELNAEP    491 - 560
SQMQIPKETKAEDEDIVLTPDGTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAA    561 - 630
SKDGRLRVNDQLIAVNGESLLGKTNQDAMETLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPPGPE    631 - 700
LPIETALDDRERRISHSLYSGIEGLDESPSRNAALSRIMGESGKYQLSPTVNMPQDDTVIIEDDRLPVLP    701 - 770
PHLSDQSSSSSHDDVGFVTADAGTWAKAAISDSADCSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDAS    771 - 840
QLDFVKTRKSKSMDLGIADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEVTLNGDIPFHR    841 - 910
PRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMETLEEDTEESSRSGRESVSTASDQPSHSLERQMNG    911 - 980
NQEKGDKTDRKKDKTGKEKKKDRDKEKDKMKAKKGMLKGLGDMFRFGKHRKDDKIEKTGKIKIQESFTSE    981 - 1050
EERIRMKQEQERIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREG   1051 - 1120
HMMDALYAQVKKPRNSKPSPVDSNRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQPWPNARPAT   1121 - 1190
QSGRHSVSVEVQMQRQRQEERESSQQAQRQYSSLPRQSRKNASSVSQDSWEQNYSPGEGFQSAKENPRYS   1191 - 1260
SYQGSRNGYLGGHGFNARVMLETQELLRQEQRRKEQQMKKQPPSEGPSNYDSYKKVQDPSYAPPKGPFRQ   1261 - 1330
DVPPSPSQVARLNRLQTPEKGRPFYS                                               1331 - 1356
//

Text Mined References (98)

PMID Year Title
26589794 2016 Cancer Cell Invasion in Three-dimensional Collagen Is Regulated Differentially by G?13 Protein and Discoidin Domain Receptor 1-Par3 Protein Signaling.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26116754 2015 PARD3 induces TAZ activation and cell growth by promoting LATS1 and PP1 interaction.
26050620 2016 Shp2 promotes metastasis of prostate cancer by attenuating the PAR3/PAR6/aPKC polarity protein complex and enhancing epithelial-to-mesenchymal transition.
25833829 2015 PARD3 Inactivation in Lung Squamous Cell Carcinomas Impairs STAT3 and Promotes Malignant Invasion.
25820151 2015 Par-3 modulates intestinal epithelial barrier function through regulating intracellular trafficking of occludin and myosin light chain phosphorylation.
25518939 2015 PAR3 and aPKC regulate Golgi organization through CLASP2 phosphorylation to generate cell polarity.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24856572 2014 Cytoplasmic PAR-3 protein expression is associated with adverse prognostic factors in clear cell renal cell carcinoma and independently impacts survival.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...