Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q8TEV8
Symbols NCRNA00034

Gene

 Compartment GO Term (0)

AA Sequence

MRRCLRVKTRRGQLGLASSCFEQHSCFSPRVNRILSAVQNTLCTGPSSQAPPQPPQASPPAAADHSRTPS      1 - 70
LLASSHSASGGESLFQLYIASLAWPQNCCVLESCRRIPLGGLSSMENRRPLLRKGRLLRGQIHHSQTNEL     71 - 140
//

Text Mined References (1)

PMID Year Title
11997338 2002 Genes in a refined Smith-Magenis syndrome critical deletion interval on chromosome 17p11.2 and the syntenic region of the mouse.