Property Summary

NCBI Gene PubMed Count 12
Grant Count 7
R01 Count 5
Funding $560,476
PubMed Score 4.74
PubTator Score 5.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma 1.300 0.025
psoriasis -3.100 0.000
facioscapulohumeral dystrophy 1.900 0.008

Gene RIF (6)

PMID Text
23829672 Data suggest that myostatin binding to its receptor (activin receptors type II) can be blocked by WFIKKN1 but not WFIKKN2; various forms of myostatin (promyostatin, myostatin pro-domain, and latent/processed myostatin) bind WFIKKN1 but not WFIKKN2.
22395277 After eccentric exercise, postmenopausal women not using hormone therapy (HT) expressed higher levels of GASP-1 while postmenopausal women using HT showed a significant increased expression over controls.
21054789 data indicate that WFIKKN proteins are antagonists of GDF8 and GDF11, but in the case of TGFbeta1, BMP2 and BMP4 they function as growth factor binding proteins
20026378 Creatine supplementation in conjunction with resistance training lead to greater decreases in serum myostatin (p<0.05), but had not additional effect on GASP-1 (p>0.05).
18596030 Both WFIKKN1 and WFIKKN2 have high affinity for growth and differentiation factors 8 and 11.
11928817 Newly discovered WFIKKNPR gene structure and tissue distribution of gene expression is commpared with that of the WFIKKN gene in adult and fetal tissues and organs

AA Sequence

MWAPRCRRFWSRWEQVAALLLLLLLLGVPPRSLALPPIRYSHAGICPNDMNPNLWVDAQSTCRRECETDQ      1 - 70
ECETYEKCCPNVCGTKSCVAARYMDVKGKKGPVGMPKEATCDHFMCLQQGSECDIWDGQPVCKCKDRCEK     71 - 140
EPSFTCASDGLTYYNRCYMDAEACSKGITLAVVTCRYHFTWPNTSPPPPETTMHPTTASPETPELDMAAP    141 - 210
ALLNNPVHQSVTMGETVSFLCDVVGRPRPEITWEKQLEDRENVVMRPNHVRGNVVVTNIAQLVIYNAQLQ    211 - 280
DAGIYTCTARNVAGVLRADFPLSVVRGHQAAATSESSPNGTAFPAAECLKPPDSEDCGEEQTRWHFDAQA    281 - 350
NNCLTFTFGHCHRNLNHFETYEACMLACMSGPLAACSLPALQGPCKAYAPRWAYNSQTGQCQSFVYGGCE    351 - 420
GNGNNFESREACEESCPFPRGNQRCRACKPRQKLVTSFCRSDFVILGRVSELTEEPDSGRALVTVDEVLK    421 - 490
DEKMGLKFLGQEPLEVTLLHVDWACPCPNVTVSEMPLIIMGEVDGGMAMLRPDSFVGASSARRVRKLREV    491 - 560
MHKKTCDVLKEFLGLH                                                          561 - 576
//

Text Mined References (12)

PMID Year Title
23829672 2013 Latent myostatin has significant activity and this activity is controlled more efficiently by WFIKKN1 than by WFIKKN2.
22395277 2012 Hormone therapy and maximal eccentric exercise alters myostatin-related gene expression in postmenopausal women.
21054789 2010 WFIKKN1 and WFIKKN2 bind growth factors TGF?1, BMP2 and BMP4 but do not inhibit their signalling activity.
20026378 2010 Effects of oral creatine and resistance training on serum myostatin and GASP-1.
18596030 2008 Both WFIKKN1 and WFIKKN2 have high affinity for growth and differentiation factors 8 and 11.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12709070 2003 Expression, purification and characterization of the second Kunitz-type protease inhibitor domain of the human WFIKKN protein.
12595574 2003 Regulation of myostatin in vivo by growth and differentiation factor-associated serum protein-1: a novel protein with protease inhibitor and follistatin domains.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...