Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.95
PubTator Score 5.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.3e-72
facioscapulohumeral dystrophy 288 7.7e-03
ependymoma 4679 2.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma 1.300 2.5e-02
facioscapulohumeral dystrophy 1.900 7.7e-03
psoriasis -3.100 3.3e-72

Gene RIF (8)

AA Sequence

MWAPRCRRFWSRWEQVAALLLLLLLLGVPPRSLALPPIRYSHAGICPNDMNPNLWVDAQSTCRRECETDQ      1 - 70
ECETYEKCCPNVCGTKSCVAARYMDVKGKKGPVGMPKEATCDHFMCLQQGSECDIWDGQPVCKCKDRCEK     71 - 140
EPSFTCASDGLTYYNRCYMDAEACSKGITLAVVTCRYHFTWPNTSPPPPETTMHPTTASPETPELDMAAP    141 - 210
ALLNNPVHQSVTMGETVSFLCDVVGRPRPEITWEKQLEDRENVVMRPNHVRGNVVVTNIAQLVIYNAQLQ    211 - 280
DAGIYTCTARNVAGVLRADFPLSVVRGHQAAATSESSPNGTAFPAAECLKPPDSEDCGEEQTRWHFDAQA    281 - 350
NNCLTFTFGHCHRNLNHFETYEACMLACMSGPLAACSLPALQGPCKAYAPRWAYNSQTGQCQSFVYGGCE    351 - 420
GNGNNFESREACEESCPFPRGNQRCRACKPRQKLVTSFCRSDFVILGRVSELTEEPDSGRALVTVDEVLK    421 - 490
DEKMGLKFLGQEPLEVTLLHVDWACPCPNVTVSEMPLIIMGEVDGGMAMLRPDSFVGASSARRVRKLREV    491 - 560
MHKKTCDVLKEFLGLH                                                          561 - 576
//

Text Mined References (14)

PMID Year Title