Property Summary

NCBI Gene PubMed Count 4
PubMed Score 74.47
PubTator Score 92.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 8.24238740525837E-6
ovarian cancer 8492 1.15678070083589E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.45329097775535E-4
group 3 medulloblastoma 2254 2.11858078693225E-4
pilocytic astrocytoma 3086 2.49361393812199E-4
tuberculosis 1563 3.76852226631554E-4
interstitial cystitis 2299 5.17610265909346E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00169962349320201
psoriasis 6685 0.00195134426466097
medulloblastoma, large-cell 6234 0.00310919479787825
Disease Target Count Z-score Confidence
Breast cancer 3099 0.0 1.0
Disease Target Count Z-score Confidence
Adenoma 165 3.533 1.8
Acromegaly 40 3.31 1.7

Expression

  Differential Expression (11)

Synonym

Accession Q8TER0 B5MDC3 B7WNK6 B7WPM0 Q336F4 Q336F5 Q8N369 Q8TEP7
Symbols SST3
Snep

Gene

  Ortholog (7)

Species Source
Mouse EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog EggNOG Inparanoid
Pig EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus EggNOG Inparanoid
Anole lizard EggNOG Inparanoid

Pathway (1)

AA Sequence

MRHGVAWALLVAAALGLGARGVRGAVALADFYPFGAERGDAVTPKQDDGGSGLRPLSVPFPFFGAEHSGL      1 - 70
YVNNNGIISFLKEVSQFTPVAFPIAKDRCVVAAFWADVDNRRAGDVYYREATDPAMLRRATEDVRHYFPE     71 - 140
LLDFNATWVFVATWYRVTFFGGSSSSPVNTFQTVLITDGKLSFTIFNYESIVWTTGTHASSGGNATGLGG    141 - 210
IAAQAGFNAGDGQRYFSIPGSRTADMAEVETTTNVGVPGRWAFRIDDAQVRVGGCGHTTSVCLALRPCLN    211 - 280
GGKCIDDCVTGNPSYTCSCLSGFTGRRCHLDVNECASQPCQNGGTCTHGINSFRCQCPAGFGGPTCETAQ    281 - 350
SPCDTKECQHGGQCQVENGSAVCVCQAGYTGAACEMDVDDCSPDPCLNGGSCVDLVGNYTCLCAEPFKGL    351 - 420
RCETGDHPVPDACLSAPCHNGGTCVDADQGYVCECPEGFMGLDCRERVPDDCECRNGGRCLGANTTLCQC    421 - 490
PLGFFGLLCEFEITAMPCNMNTQCPDGGYCMEHGGSYLCVCHTDHNASHSLPSPCDSDPCFNGGSCDAHD    491 - 560
DSYTCECPRGFHGKHCEKARPHLCSSGPCRNGGTCKEAGGEYHCSCPYRFTGRHCEIGKPDSCASGPCHN    561 - 630
GGTCFHYIGKYKCDCPPGFSGRHCEIAPSPCFRSPCVNGGTCEDRDTDFFCHCQAGYMGRRCQAEVDCGP    631 - 700
PEEVKHATLRFNGTRLGAVALYACDRGYSLSAPSRIRVCQPHGVWSEPPQCLEIDECRSQPCLHGGSCQD    701 - 770
RVAGYLCLCSTGYEGAHCELERDECRAHPCRNGGSCRNLPGAYVCRCPAGFVGVHCETEVDACDSSPCQH    771 - 840
GGRCESGGGAYLCVCPESFFGYHCETVSDPCFSSPCGGRGYCLASNGSHSCTCKVGYTGEDCAKELFPPT    841 - 910
ALKMERVEESGVSISWNPPNGPAARQMLDGYAVTYVSSDGSYRRTDFVDRTRSSHQLQALAAGRAYNISV    911 - 980
FSVKRNSNNKNDISRPAVLLARTRPRPVEGFEVTNVTASTISVQWALHRIRHATVSGVRVSIRHPEALRD    981 - 1050
QATDVDRSVDRFTFRALLPGKRYTIQLTTLSGLRGEEHPTESLATAPTHVWTRPLPPANLTAARVTATSA   1051 - 1120
HVVWDAPTPGSLLEAYVINVTTSQSTKSRYVPNGKLASYTVRDLLPGRRYQLSVIAVQSTELGPQHSEPA   1121 - 1190
HLYIITSPRDGADRRWHQGGHHPRVLKNRPPPARLPELRLLNDHSAPETPTQPPRFSELVDGRGRVSARF   1191 - 1260
GGSPSKAATVRSQPTASAQLENMEEAPKRVSLALQLPEHGSKDIGNVPGNCSENPCQNGGTCVPGADAHS   1261 - 1330
CDCGPGFKGRRCELACIKVSRPCTRLFSETKAFPVWEGGVCHHVYKRVYRVHQDICFKESCESTSLKKTP   1331 - 1400
NRKQSKSQTLEKS                                                            1401 - 1413
//

Text Mined References (7)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22675492 2012 Genome-wide association study of circulating estradiol, testosterone, and sex hormone-binding globulin in postmenopausal women.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15194686 2004 Insulin-response element-binding protein 1: a novel Akt substrate involved in transcriptional action of insulin.
15162516 2004 Cloning and expression analysis of the mouse stroma marker Snep encoding a novel nidogen domain protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.