Property Summary

NCBI Gene PubMed Count 17
PubMed Score 10.63
PubTator Score 4.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Hyperphosphatasia with Mental Retardation 5 0.0 0.0
Disease Target Count P-value
ependymoma 4679 6.0e-13
osteosarcoma 7950 1.2e-07
atypical teratoid / rhabdoid tumor 5112 2.4e-07
psoriasis 6694 1.1e-04
glioblastoma 5792 7.9e-04
lung cancer 4740 8.8e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Intellectual disability 1016 3.647 1.8
Disease Target Count Z-score Confidence
Iridogoniodysgenesis syndrome 9 4.472 2.2
Epilepsy 792 3.129 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 2.4e-07
ependymoma 1.200 6.0e-13
glioblastoma 1.200 7.9e-04
lung cancer 1.400 8.8e-04
osteosarcoma 1.563 1.2e-07
psoriasis 1.700 1.1e-04

Protein-protein Interaction (2)

Gene RIF (6)

AA Sequence

MQKASVLLFLAWVCFLFYAGIALFTSGFLLTRLELTNHSSCQEPPGPGSLPWGSQGKPGACWMASRFSRV      1 - 70
VLVLIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRSQVDPPTTTMQRLKALTT     71 - 140
GSLPTFIDAGSNFASHAIVEDNLIKQLTSAGRRVVFMGDDTWKDLFPGAFSKAFFFPSFNVRDLDTVDNG    141 - 210
ILEHLYPTMDSGEWDVLIAHFLGVDHCGHKHGPHHPEMAKKLSQMDQVIQGLVERLENDTLLVVAGDHGM    211 - 280
TTNGDHGGDSELEVSAALFLYSPTAVFPSTPPEEPEVIPQVSLVPTLALLLGLPIPFGNIGEVMAELFSG    281 - 350
GEDSQPHSSALAQASALHLNAQQVSRFLHTYSAATQDLQAKELHQLQNLFSKASADYQWLLQSPKGAEAT    351 - 420
LPTVIAELQQFLRGARAMCIESWARFSLVRMAGGTALLAASCFICLLASQWAISPGFPFCPLLLTPVAWG    421 - 490
LVGAIAYAGLLGTIELKLDLVLLGAVAAVSSFLPFLWKAWAGWGSKRPLATLFPIPGPVLLLLLFRLAVF    491 - 560
FSDSFVVAEARATPFLLGSFILLLVVQLHWEGQLLPPKLLTMPRLGTSATTNPPRHNGAYALRLGIGLLL    561 - 630
CTRLAGLFHRCPEETPVCHSSPWLSPLASMVGGRAKNLWYGACVAALVALLAAVRLWLRRYGNLKSPEPP    631 - 700
MLFVRWGLPLMALGTAAYWALASGADEAPPRLRVLVSGASMVLPRAVAGLAASGLALLLWKPVTVLVKAG    701 - 770
AGAPRTRTVLTPFSGPPTSQADLDYVVPQIYRHMQEEFRGRLERTKSQGPLTVAAYQLGSVYSAAMVTAL    771 - 840
TLLAFPLLLLHAERISLVFLLLFLQSFLLLHLLAAGIPVTTPGPFTVPWQAVSAWALMATQTFYSTGHQP    841 - 910
VFPAIHWHAAFVGFPEGHGSCTWLPALLVGANTFASHLLFAVGCPLLLLWPFLCESQGLRKRQQPPGNEA    911 - 980
DARVRPEEEEEPLMEMRLRDAPQHFYAALLQLGLKYLFILGIQILACALAASILRRHLMVWKVFAPKFIF    981 - 1050
EAVGFIVSSVGLLLGIALVMRVDGAVSSWFRQLFLAQQR                                  1051 - 1089
//

Text Mined References (22)

PMID Year Title