Property Summary

NCBI Gene PubMed Count 28
Grant Count 7
R01 Count 5
Funding $1,081,047.5
PubMed Score 20.38
PubTator Score 16.90

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 1.100 0.000

Gene RIF (13)

PMID Text
26069323 Gemin5 is dispensable for snRNA identification and snRNP assembly.
25911097 This work both reveals a new autoregulatory pathway governing SMN expression, and identifies a new mechanism through which SMN can modulate specific mRNA expression via Gemin5.
25631074 Cellular biotinylated gem-associated protein 5 (GEMIN5) protein is incorporated into HIV-1 Gag virus-like particles
24598255 The C-terminal region of Gemin5 bears two non-canonical bipartite RNA-binding sites.
20513430 The Gemin5's function in delivering pre-snRNAs as substrates for Sm core assembly and processing.
19750007 gemin5 has a role as a novel cap-binding protein and WD repeat domains are involved in m(7)G recognition
19377484 The entire WD repeat domain, comprising 13 WD motifs, is both necessary and sufficient for sequence-specific, high-affinity binding of Gemin5 to its RNA targets.
18245461 The data provide the first demonstration that alterations in the expression of Gemin5, a spliceosome protein, can effect both specific splicing events and tumor cell motility.
17640873 Gemin5-containing subunits bind small nuclear RNA independently of the SMN complex and without a requirement for exogenous ATP
17640370 Absence of GEMIN5 from SMN complexes in nuclear Cajal bodies is demonstrated.
More...

AA Sequence

MGQEPRTLPPSPNWYCARCSDAVPGGLFGFAARTSVFLVRVGPGAGESPGTPPFRVIGELVGHTERVSGF      1 - 70
TFSHHPGQYNLCATSSDDGTVKIWDVETKTVVTEHALHQHTISTLHWSPRVKDLIVSGDEKGVVFCYWFN     71 - 140
RNDSQHLFIEPRTIFCLTCSPHHEDLVAIGYKDGIVVIIDISKKGEVIHRLRGHDDEIHSIAWCPLPGED    141 - 210
CLSINQEETSEEAEITNGNAVAQAPVTKGCYLATGSKDQTIRIWSCSRGRGVMILKLPFLKRRGGGIDPT    211 - 280
VKERLWLTLHWPSNQPTQLVSSCFGGELLQWDLTQSWRRKYTLFSASSEGQNHSRIVFNLCPLQTEDDKQ    281 - 350
LLLSTSMDRDVKCWDIATLECSWTLPSLGGFAYSLAFSSVDIGSLAIGVGDGMIRVWNTLSIKNNYDVKN    351 - 420
FWQGVKSKVTALCWHPTKEGCLAFGTDDGKVGLYDTYSNKPPQISSTYHKKTVYTLAWGPPVPPMSLGGE    421 - 490
GDRPSLALYSCGGEGIVLQHNPWKLSGEAFDINKLIRDTNSIKYKLPVHTEISWKADGKIMALGNEDGSI    491 - 560
EIFQIPNLKLICTIQQHHKLVNTISWHHEHGSQPELSYLMASGSNNAVIYVHNLKTVIESSPESPVTITE    561 - 630
PYRTLSGHTAKITSVAWSPHHDGRLVSASYDGTAQVWDALREEPLCNFRGHRGRLLCVAWSPLDPDCIYS    631 - 700
GADDFCVHKWLTSMQDHSRPPQGKKSIELEKKRLSQPKAKPKKKKKPTLRTPVKLESIDGNEEESMKENS    701 - 770
GPVENGVSDQEGEEQAREPELPCGLAPAVSREPVICTPVSSGFEKSKVTINNKVILLKKEPPKEKPETLI    771 - 840
KKRKARSLLPLSTSLDHRSKEELHQDCLVLATAKHSRELNEDVSADVEERFHLGLFTDRATLYRMIDIEG    841 - 910
KGHLENGHPELFHQLMLWKGDLKGVLQTAAERGELTDNLVAMAPAAGYHVWLWAVEAFAKQLCFQDQYVK    911 - 980
AASHLLSIHKVYEAVELLKSNHFYREAIAIAKARLRPEDPVLKDLYLSWGTVLERDGHYAVAAKCYLGAT    981 - 1050
CAYDAAKVLAKKGDAASLRTAAELAAIVGEDELSASLALRCAQELLLANNWVGAQEALQLHESLQGQRLV   1051 - 1120
FCLLELLSRHLEEKQLSEGKSSSSYHTWNTGTEGPFVERVTAVWKSIFSLDTPEQYQEAFQKLQNIKYPS   1121 - 1190
ATNNTPAKQLLLHICHDLTLAVLSQQMASWDEAVQALLRAVVRSYDSGSFTIMQEVYSAFLPDGCDHLRD   1191 - 1260
KLGDHQSPATPAFKSLEAFFLYGRLYEFWWSLSRPCPNSSVWVRAGHRTLSVEPSQQLDTASTEETDPET   1261 - 1330
SQPEPNRPSELDLRLTEEGERMLSTFKELFSEKHASLQNSQRTVAEVQETLAEMIRQHQKSQLCKSTANG   1331 - 1400
PDKNEPEVEAEQPLCSSQSQCKEEKNEPLSLPELTKRLTEANQRMAKFPESIKAWPFPDVLECCLVLLLI   1401 - 1470
RSHFPGCLAQEMQQQAQELLQKYGNTKTYRRHCQTFCM                                   1471 - 1508
//

Text Mined References (36)

PMID Year Title
26069323 2015 Reconstitution of the human U snRNP assembly machinery reveals stepwise Sm protein organization.
25911097 2015 Gemin5 Binds to the Survival Motor Neuron mRNA to Regulate SMN Expression.
24598255 2014 Identification of novel non-canonical RNA-binding sites in Gemin5 involved in internal initiation of translation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20513430 2010 Gemin5 delivers snRNA precursors to the SMN complex for snRNP biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
More...