Property Summary

NCBI Gene PubMed Count 19
Grant Count 6
Funding $303,815.8
PubMed Score 23.93
PubTator Score 5.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 2.100 0.000
diabetes mellitus -1.100 0.002

Gene RIF (7)

PMID Text
26038816 TRUSS is a novel substrate of E3 ligase Skp2.
20551172 TRPC4AP/TRUSS binds specifically to the Myc C terminus and promotes its ubiquitination and destruction through the recognition of evolutionarily conserved domains in the Myc N terminus
20458742 These findings suggest that TNF-R1, TRUSS, and TRPC4 augment Ca(2+) loading of endoplasmic reticulum Ca(2+) stores in the context of m1AchR stimulation
19059308 The latent classification method of analysis showed that the TRPC4AP H1 haplotype was characteristic of Alzheimer's patients, with ages-of-onset between 66 and 80 years.
19059308 Observational study of gene-disease association. (HuGE Navigator)
18449908 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18449908 results suggest that TRPC4AP is involved with the disease in these late-onset Alzheimer's families

AA Sequence

MAAAPVAAGSGAGRGRRSAATVAAWGGWGGRPRPGNILLQLRQGQLTGRGLVRAVQFTETFLTERDKQSK      1 - 70
WSGIPQLLLKLHTTSHLHSDFVECQNILKEISPLLSMEAMAFVTEERKLTQETTYPNTYIFDLFGGVDLL     71 - 140
VEILMRPTISIRGQKLKISDEMSKDCLSILYNTCVCTEGVTKRLAEKNDFVIFLFTLMTSKKTFLQTATL    141 - 210
IEDILGVKKEMIRLDEVPNLSSLVSNFDQQQLANFCRILAVTISEMDTGNDDKHTLLAKNAQQKKSLSLG    211 - 280
PSAAEINQAALLSIPGFVERLCKLATRKVSESTGTASFLQELEEWYTWLDNALVLDALMRVANEESEHNQ    281 - 350
ASIVFPPPGASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVHRMIAEFKLIPGL    351 - 420
NNLFDKLIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQELNELSAISLK    421 - 490
ANIPEVEAVLNTDRSLVCDGKRGLLTRLLQVMKKEPAESSFRFWQARAVESFLRGTTSYADQMFLLKRGL    491 - 560
LEHILYCIVDSECKSRDVLQSYFDLLGELMKFNVDAFKRFNKYINTDAKFQVFLKQINSSLVDSNMLVRC    561 - 630
VTLSLDRFENQVDMKVAEVLSECRLLAYISQVPTQMSFLFRLINIIHVQTLTQENVSCLNTSLVILMLAR    631 - 700
RKERLPLYLRLLQRMEHSKKYPGFLLNNFHNLLRFWQQHYLHKDKDSTCLENSSCISFSYWKETVSILLN    701 - 770
PDRQSPSALVSYIEEPYMDIDRDFTEE                                               771 - 797
//

Text Mined References (23)

PMID Year Title
26038816 2015 The G1 phase E3 ubiquitin ligase TRUSS that gets deregulated in human cancers is a novel substrate of the S-phase E3 ubiquitin ligase Skp2.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22703881 2012 Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease.
20551172 2010 Myc protein is stabilized by suppression of a novel E3 ligase complex in cancer cells.
20458742 2010 TRUSS, TNF-R1, and TRPC ion channels synergistically reverse endoplasmic reticulum Ca2+ storage reduction in response to m1 muscarinic acetylcholine receptor signaling.
19966799 2010 A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
19059308 2009 The frequency of the TRPC4AP haplotype in Alzheimer's patients.
18449908 2009 Genome screen of late-onset Alzheimer's extended pedigrees identifies TRPC4AP by haplotype analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...