Property Summary

NCBI Gene PubMed Count 19
PubMed Score 23.93
PubTator Score 5.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 1.6e-05
diabetes mellitus 1728 1.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Intestinal perforation 7 3.42 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.100 1.9e-03
psoriasis 2.100 1.6e-05

Synonym

Accession Q8TEL6 E1P5Q0 E1P5Q1 Q96H82 Q9BVB8 Q9H429 Q9UFS6 Trp4-associated protein
Symbols TRUSS
TRRP4AP
PPP1R158
C20orf188

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (7)

AA Sequence

MAAAPVAAGSGAGRGRRSAATVAAWGGWGGRPRPGNILLQLRQGQLTGRGLVRAVQFTETFLTERDKQSK      1 - 70
WSGIPQLLLKLHTTSHLHSDFVECQNILKEISPLLSMEAMAFVTEERKLTQETTYPNTYIFDLFGGVDLL     71 - 140
VEILMRPTISIRGQKLKISDEMSKDCLSILYNTCVCTEGVTKRLAEKNDFVIFLFTLMTSKKTFLQTATL    141 - 210
IEDILGVKKEMIRLDEVPNLSSLVSNFDQQQLANFCRILAVTISEMDTGNDDKHTLLAKNAQQKKSLSLG    211 - 280
PSAAEINQAALLSIPGFVERLCKLATRKVSESTGTASFLQELEEWYTWLDNALVLDALMRVANEESEHNQ    281 - 350
ASIVFPPPGASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVHRMIAEFKLIPGL    351 - 420
NNLFDKLIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQELNELSAISLK    421 - 490
ANIPEVEAVLNTDRSLVCDGKRGLLTRLLQVMKKEPAESSFRFWQARAVESFLRGTTSYADQMFLLKRGL    491 - 560
LEHILYCIVDSECKSRDVLQSYFDLLGELMKFNVDAFKRFNKYINTDAKFQVFLKQINSSLVDSNMLVRC    561 - 630
VTLSLDRFENQVDMKVAEVLSECRLLAYISQVPTQMSFLFRLINIIHVQTLTQENVSCLNTSLVILMLAR    631 - 700
RKERLPLYLRLLQRMEHSKKYPGFLLNNFHNLLRFWQQHYLHKDKDSTCLENSSCISFSYWKETVSILLN    701 - 770
PDRQSPSALVSYIEEPYMDIDRDFTEE                                               771 - 797
//

Text Mined References (23)

PMID Year Title