Property Summary

NCBI Gene PubMed Count 56
Grant Count 102
R01 Count 70
Funding $10,275,287.69
PubMed Score 182.28
PubTator Score 102.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.200 0.020
osteosarcoma -1.264 0.000
medulloblastoma 1.800 0.000
atypical teratoid / rhabdoid tumor 1.800 0.000
glioblastoma 1.400 0.000
medulloblastoma, large-cell 1.600 0.000
primitive neuroectodermal tumor 1.500 0.000

Synonym

Accession Q8TEK3 O60379 Q96JL1
Symbols DOT1
KMT4

Gene

PANTHER Protein Class (2)

PDB

2MV7   1NW3   3QOW   3QOX   3SR4   3SX0   3UWP   4EK9   4EKG   4EKI   4EQZ   4ER0   4ER3   4ER5   4ER6   4ER7   4HRA   4WVL   5DRT   5DRY   5DSX   5DT2   5DTM   5DTQ   5DTR   5JUW  

 IMPC Term (1)

Gene RIF (43)

PMID Text
27002147 these findings strongly support the contention that histone methyltransferase, DOT1L-associated epigenetic changes induced by HA play pivotal roles in miR-10 production leading to up-regulation of RhoGTPase and survival proteins.
26927674 MLL1 and DOT1L cooperate with meningioma-1 to induce acute myeloid leukemia.
26830124 These data converge on a possible mechanism for hDot1L stimulation in which histone H2B physically 'corrals' the enzyme into a productive binding orientation.
26439302 The PZP domain of AF10 senses unmodified H3K27 to regulate DOT1L-mediated methylation of H3K79.
26385168 Report drug formulation/delivery of DOT1L inhibitor pinometostat in leukemia.
26240340 analysis of a functional hotspot on ubiquitin that is required for the stimulation of human Dot1
26199140 expression associated with poorer survival and aggressiveness of breast cancers
26118503 Targeting DOT1L and HOX gene expression in MLL-rearranged leukemia and beyond.
25921540 The graded reduction of the DOT1L interaction with MLL-AF9 results in differential loss of H3K79me2 and me3 at MLL-AF9 target genes.
25576241 Three candidate variants were identified: p.Glu1313Lys in Insulin receptor (INSR), p.Arg81Pro in F-box protein 24 (FBXO24) and p.Pro1146Leu in DOT1-like histone H3K79 methyltransferase
More...

AA Sequence

MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFES      1 - 70
MQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETS     71 - 140
FDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYG    141 - 210
KKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRIN    211 - 280
SRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRESK    281 - 350
SNAATPTKGPEGKVAGPADAPMDSGAEEEKAGAATVKKPSPSKARKKKLNKKGRKMAGRKRGRPKKMNTA    351 - 420
NPERKPKKNQTALDALHAQTVSQTAASSPQDAYRSPHSPFYQLPPSVQRHSPNPLLVAPTPPALQKLLES    421 - 490
FKIQYLQFLAYTKTPQYKASLQELLGQEKEKNAQLLGAAQQLLSHCQAQKEEIRRLFQQKLDELGVKALT    491 - 560
YNDLIQAQKEISAHNQQLREQSEQLEQDNRALRGQSLQLLKARCEELQLDWATLSLEKLLKEKQALKSQI    561 - 630
SEKQRHCLELQISIVELEKSQRQQELLQLKSCVPPDDALSLHLRGKGALGRELEPDASRLHLELDCTKFS    631 - 700
LPHLSSMSPELSMNGQAAGYELCGVLSRPSSKQNTPQYLASPLDQEVVPCTPSHVGRPRLEKLSGLAAPD    701 - 770
YTRLSPAKIVLRRHLSQDHTVPGRPAASELHSRAEHTKENGLPYQSPSVPGSMKLSPQDPRPLSPGALQL    771 - 840
AGEKSSEKGLRERAYGSSGELITSLPISIPLSTVQPNKLPVSIPLASVVLPSRAERARSTPSPVLQPRDP    841 - 910
SSTLEKQIGANAHGAGSRSLALAPAGFSYAGSVAISGALAGSPASLTPGAEPATLDESSSSGSLFATVGS    911 - 980
RSSTPQHPLLLAQPRNSLPASPAHQLSSSPRLGGAAQGPLPEASKGDLPSDSGFSDPESEAKRRIVFTIT    981 - 1050
TGAGSAKQSPSSKHSPLTASARGDCVPSHGQDSRRRGRRKRASAGTPSLSAGVSPKRRALPSVAGLFTQP   1051 - 1120
SGSPLNLNSMVSNINQPLEITAISSPETSLKSSPVPYQDHDQPPVLKKERPLSQTNGAHYSPLTSDEEPG   1121 - 1190
SEDEPSSARIERKIATISLESKSPPKTLENGGGLAGRKPAPAGEPVNSSKWKSTFSPISDIGLAKSADSP   1191 - 1260
LQASSALSQNSLFTFRPALEEPSADAKLAAHPRKGFPGSLSGADGLSPGTNPANGCTFGGGLAADLSLHS   1261 - 1330
FSDGASLPHKGPEAAGLSSPLSFPSQRGKEGSDANPFLSKRQLDGLAGLKGEGSRGKEAGEGGLPLCGPT   1331 - 1400
DKTPLLSGKAAKARDREVDLKNGHNLFISAAAVPPGSLLSGPGLAPAASSAGGAASSAQTHRSFLGPFPP   1401 - 1470
GPQFALGPMSLQANLGSVAGSSVLQSLFSSVPAAAGLVHVSSAATRLTNSHAMGSFSGVAGGTVGGVVFN   1471 - 1540
HAVPSASAHPFGARVGRGAACGSATLGPSPLQAAASASASSFQAPASVETRPPPPPPPPPPPLPPPAHLG   1541 - 1610
RSPAGPPVLHAPPPPNAALPPPPTLLASNPEPALLQSLASLPPNQAFLPPTSAASLPPANASLSIKLTSL   1611 - 1680
PHKGARPSFTVHHQPLPRLALAQAAPGIPQASATGPSAVWVSLGMPPPYAAHLSGVKPR              1681 - 1739
//

Text Mined References (64)

PMID Year Title
27002147 2016 Up-regulation of Histone Methyltransferase, DOT1L, by Matrix Hyaluronan Promotes MicroRNA-10 Expression Leading to Tumor Cell Invasion and Chemoresistance in Cancer Stem Cells from Head and Neck Squamous Cell Carcinoma.
26927674 2016 MLL1 and DOT1L cooperate with meningioma-1 to induce acute myeloid leukemia.
26830124 2016 Evidence that ubiquitylated H2B corrals hDot1L on the nucleosomal surface to induce H3K79 methylation.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26439302 2015 The PZP Domain of AF10 Senses Unmodified H3K27 to Regulate DOT1L-Mediated Methylation of H3K79.
26385168 2015 Exploring drug delivery for the DOT1L inhibitor pinometostat (EPZ-5676): Subcutaneous administration as an alternative to continuous IV infusion, in the pursuit of an epigenetic target.
26240340 2015 Identification of a functional hotspot on ubiquitin required for stimulation of methyltransferase activity on chromatin.
26199140 2015 DOT1L cooperates with the c-Myc-p300 complex to epigenetically derepress CDH1 transcription factors in breast cancer progression.
26118503 2015 Targeting DOT1L and HOX gene expression in MLL-rearranged leukemia and beyond.
25921540 2015 Degree of recruitment of DOT1L to MLL-AF9 defines level of H3K79 Di- and tri-methylation on target genes and transformation potential.
More...