Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.22
PubTator Score 1.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Amphetamine-Related Disorders 74
Disease Target Count P-value
ovarian cancer 8492 4.87394903937172E-4
chronic rhinosinusitis 512 0.00234302666603606
group 4 medulloblastoma 1875 0.00384382176410182
gastric carcinoma 832 0.00729176428979483
atypical teratoid / rhabdoid tumor 4369 0.00968900285559176
invasive ductal carcinoma 2950 0.0133973831005441

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 0.010
group 4 medulloblastoma -2.000 0.004
gastric carcinoma 1.500 0.007
invasive ductal carcinoma -1.200 0.013
ovarian cancer 1.500 0.000
chronic rhinosinusitis -1.206 0.002

Synonym

Accession Q8TEJ3 A0SDZ7 A8MPR1 Q8NDU1
Symbols POSH2
SH3MD4

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (2)

PMID Text
20696164 POSH2 was found to have a conserved N-terminal extension not present in POSH1 and POSH3. POSH2 has GTP-loaded Rac1 binding activity and this activity was mapped to a partial Cdc42/Rac-interactive binding (CRIB) domain.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MLLGASWLCASKAAAAAAQSEGDEDRPGERRRRRAAATAAGAGEDMDESSLLDLLECSVCLERLDTTAKV      1 - 70
LPCQHTFCRRCLESIVCSRHELRCPECRILVGCGVDELPANILLVRLLDGIRQRPRAGTSPGGSPPARPI     71 - 140
PGQSAAPTLAGGGGGAAGSTPGSPVFLSAAAGSTAGSLRELATSRTAPAAKNPCLLPYGKALYSYEGKEP    141 - 210
GDLKFNKGDIIVLRRKVDEQWYHGELHGTQGFLPASYIQCIQPLPHAPPQGKALYDFEMKDKDQDKDCLT    211 - 280
FTKDEILTVLRRVDENWAEGMLGDKIGIFPLLYVELNDSAKQLIEMDKPCPAAASSCNASLPSDSGAVAS    281 - 350
VAPSPTLSSSGAVSAFQRRVDGKKNTKKRHSFTALSVTHRSSQAASHRHSMEISAPVLISSSDPRAAARI    351 - 420
GDLAHLSCAAPTQDVSSSAGSTPTAVPRAASVSGEQGTPPKVQLPLNVYLALYAYKPQKSDELELHKGEM    421 - 490
YRVLEKCQDGWFKGASLRTGVSGVFPGNYVTPVSRVPAGGAGPPRNNVVGGSPLAKGITTTMHPGSGSLS    491 - 560
SLATATRPALPITTPQAHAQHPTASPPTGSCLRHSAQPTASQARSTISTAAHSAAQAQDRPTATVSPLRT    561 - 630
QNSPSRLPATSLRPHSVVSPQHSHQPPVQMCPRPAIPLTSAASAITPPNVSAANLNGEAGGGPIGVLSTS    631 - 700
SPTNTGCKLDEKKSEKKEKKSGLLKLLAGASTKKKSRSPPSVSPTHDPQVAVDALLQGAVGPEVSSLSIH    701 - 770
GRAGSCPIESEMQGAMGMEPLHRKAGSLDLNFTSPSRQAPLSMAAIRPEPKLLPRERYRVVVSYPPQSEA    771 - 840
EIELKEGDIVFVHKKREDGWYKGTLQRNGRTGLFPGSFVESF                                841 - 882
//

Text Mined References (9)

PMID Year Title
20696164 2010 POSH2 is a RING finger E3 ligase with Rac1 binding activity through a partial CRIB domain.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16374509 2006 Identification of preferred protein interactions by phage-display of the human Src homology-3 proteome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12693554 2003 Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones.