Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.22
PubTator Score 1.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 0.010
group 4 medulloblastoma -2.000 0.004
gastric carcinoma 1.500 0.007
invasive ductal carcinoma -1.200 0.013
ovarian cancer 1.500 0.000
chronic rhinosinusitis -1.206 0.002

Gene RIF (2)

PMID Text
20696164 POSH2 was found to have a conserved N-terminal extension not present in POSH1 and POSH3. POSH2 has GTP-loaded Rac1 binding activity and this activity was mapped to a partial Cdc42/Rac-interactive binding (CRIB) domain.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MLLGASWLCASKAAAAAAQSEGDEDRPGERRRRRAAATAAGAGEDMDESSLLDLLECSVCLERLDTTAKV      1 - 70
LPCQHTFCRRCLESIVCSRHELRCPECRILVGCGVDELPANILLVRLLDGIRQRPRAGTSPGGSPPARPI     71 - 140
PGQSAAPTLAGGGGGAAGSTPGSPVFLSAAAGSTAGSLRELATSRTAPAAKNPCLLPYGKALYSYEGKEP    141 - 210
GDLKFNKGDIIVLRRKVDEQWYHGELHGTQGFLPASYIQCIQPLPHAPPQGKALYDFEMKDKDQDKDCLT    211 - 280
FTKDEILTVLRRVDENWAEGMLGDKIGIFPLLYVELNDSAKQLIEMDKPCPAAASSCNASLPSDSGAVAS    281 - 350
VAPSPTLSSSGAVSAFQRRVDGKKNTKKRHSFTALSVTHRSSQAASHRHSMEISAPVLISSSDPRAAARI    351 - 420
GDLAHLSCAAPTQDVSSSAGSTPTAVPRAASVSGEQGTPPKVQLPLNVYLALYAYKPQKSDELELHKGEM    421 - 490
YRVLEKCQDGWFKGASLRTGVSGVFPGNYVTPVSRVPAGGAGPPRNNVVGGSPLAKGITTTMHPGSGSLS    491 - 560
SLATATRPALPITTPQAHAQHPTASPPTGSCLRHSAQPTASQARSTISTAAHSAAQAQDRPTATVSPLRT    561 - 630
QNSPSRLPATSLRPHSVVSPQHSHQPPVQMCPRPAIPLTSAASAITPPNVSAANLNGEAGGGPIGVLSTS    631 - 700
SPTNTGCKLDEKKSEKKEKKSGLLKLLAGASTKKKSRSPPSVSPTHDPQVAVDALLQGAVGPEVSSLSIH    701 - 770
GRAGSCPIESEMQGAMGMEPLHRKAGSLDLNFTSPSRQAPLSMAAIRPEPKLLPRERYRVVVSYPPQSEA    771 - 840
EIELKEGDIVFVHKKREDGWYKGTLQRNGRTGLFPGSFVESF                                841 - 882
//

Text Mined References (9)

PMID Year Title
20696164 2010 POSH2 is a RING finger E3 ligase with Rac1 binding activity through a partial CRIB domain.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16374509 2006 Identification of preferred protein interactions by phage-display of the human Src homology-3 proteome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12693554 2003 Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones.