Property Summary

NCBI Gene PubMed Count 29
PubMed Score 11.67
PubTator Score 17.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.461 0.000
tuberculosis 2.300 0.000
ovarian cancer -1.100 0.000

Synonym

Accession Q8TEH3 A8MZA3 B1AM80 B7Z3C8 B7Z669 D3PFD3 Q05C88 Q5VWF0 Q6PJZ5 Q8IVD6 Q9H796
Symbols FAM31A
KIAA1608

Gene

Gene RIF (12)

PMID Text
26055712 The guanine nucleotide exchange factor activity of connecdenn 1 and 2 are autoinhibited, and this is regulated by Akt activation downstream of insulin stimulation.
25626177 We demonstrated lack of association of DENND1A SNPs rs10818854, rs2479106, and rs10986105, previously associated with PCOS in Asians, with PCOS in Bahraini Arab women.
24706793 DENND1A, plays a key role in the hyperandrogenemia associated with polycystic ovary syndrome.
24086769 sequence analysis of the DENND1A gene of patients with PCOS did not identify alterations that alone could be responsible for the PCOS pathogenesis
23208300 THADA and DENND1A, carry risk alleles that are associated with endocrine and metabolic disturbances in PCOS patients of Han Chinese descent.
22902918 Our results suggest that SNPs rs2479106 in gene DENND1A and rs13405728 in gene LHCGR are associated with endometrioid adenocarcinoma.
22547425 Variants in DENND1A are associated with polycystic ovary syndrome in women of European ancestry.
22504079 The rs2479106 G allele was associated with decreased PCOS susceptibility
22180642 At least two of the PCOS susceptibility loci identified in the Chinese PCOS GWAS (DENND1A and THADA) are also associated with PCOS in European derived populations.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MGSRIKQNPETTFEVYVEVAYPRTGGTLSDPEVQRQFPEDYSDQEVLQTLTKFCFPFYVDSLTVSQVGQN      1 - 70
FTFVLTDIDSKQRFGFCRLSSGAKSCFCILSYLPWFEVFYKLLNILADYTTKRQENQWNELLETLHKLPI     71 - 140
PDPGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASMLYERRILIICSKLSTLTAC    141 - 210
IHGSAAMLYPMYWQHVYIPVLPPHLLDYCCAPMPYLIGIHLSLMEKVRNMALDDVVILNVDTNTLETPFD    211 - 280
DLQSLPNDVISSLKNRLKKVSTTTGDGVARAFLKAQAAFFGSYRNALKIEPEEPITFCEEAFVSHYRSGA    281 - 350
MRQFLQNATQLQLFKQFIDGRLDLLNSGEGFSDVFEEEINMGEYAGSDKLYHQWLSTVRKGSGAILNTVK    351 - 420
TKANPAMKTVYKFAKDHAKMGIKEVKNRLKQKDIAENGCAPTPEEQLPKTAPSPLVEAKDPKLREDRRPI    421 - 490
TVHFGQVRPPRPHVVKRPKSNIAVEGRRTSVPSPEQPQPYRTLRESDSAEGDEAESPEQQVRKSTGPVPA    491 - 560
PPDRAASIDLLEDVFSNLDMEAALQPLGQAKSLEDLRAPKDLREQPGTFDYQRLDLGGSERSRGVTVALK    561 - 630
LTHPYNKLWSLGQDDMAIPSKPPAASPEKPSALLGNSLALPRRPQNRDSILNPSDKEEVPTPTLGSITIP    631 - 700
RPQGRKTPELGIVPPPPIPRPAKLQAAGAALGDVSERLQTDRDRRAALSPGLLPGVVPQGPTELLQPLSP    701 - 770
GPGAAGTSSDALLALLDPLSTAWSGSTLPSRPATPNVATPFTPQFSFPPAGTPTPFPQPPLNPFVPSMPA    771 - 840
APPTLPLVSTPAGPFGAPPASLGPAFASGLLLSSAGFCAPHRSQPNLSALSMPNLFGQMPMGTHTSPLQP    841 - 910
LGPPAVAPSRIRTLPLARSSARAAETKQGLALRPGDPPLLPPRPPQGLEPTLQPSAPQQARDPFEDLLQK    911 - 980
TKQDVSPSPALAPAPDSVEQLRKQWETFE                                             981 - 1009
//

Text Mined References (37)

PMID Year Title
26055712 2015 Phosphorylation-dependent Regulation of Connecdenn/DENND1 Guanine Nucleotide Exchange Factors.
25626177 2015 DENND1A gene variants in Bahraini Arab women with polycystic ovary syndrome.
24706793 2014 Overexpression of a DENND1A isoform produces a polycystic ovary syndrome theca phenotype.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24086769 2013 Genetic alterations within the DENND1A gene in patients with polycystic ovary syndrome (PCOS).
24025145 2013 A genome-wide association study of chemotherapy-induced alopecia in breast cancer patients.
23966867 2013 Genome-wide association of body fat distribution in African ancestry populations suggests new loci.
23517042 2013 Genome-wide association study of body mass index in 23 000 individuals with and without asthma.
23208300 2013 Genotype-phenotype correlations of PCOS susceptibility SNPs identified by GWAS in a large cohort of Han Chinese women.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...