Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.93
PubTator Score 0.95

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MTPLAPWDPKYEAKAGPRPVWGANCSSGASFSGRTLCHPSFWPLYEAASGRGLRPVAPATGHWNGQQAPP      1 - 70
DAGFPVVCCEDVFLSDPLLPRGQRVPLYLSKAPQQMMGSLKLLPPPPIMSARVLPRPSPSRGPSTAWLSG     71 - 140
PELIALTGLLQMSQGEPRPSSSAVGPPDHTSDPPSPCGSPSSSQGADLSLPQTPDTHCP               141 - 199
//

Text Mined References (4)

PMID Year Title
16449650 2006 Identification and characterization of SAP25, a novel component of the mSin3 corepressor complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.