Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.43
PubTator Score 0.95

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8TEE9
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MTPLAPWDPKYEAKAGPRPVWGANCSSGASFSGRTLCHPSFWPLYEAASGRGLRPVAPATGHWNGQQAPP      1 - 70
DAGFPVVCCEDVFLSDPLLPRGQRVPLYLSKAPQQMMGSLKLLPPPPIMSARVLPRPSPSRGPSTAWLSG     71 - 140
PELIALTGLLQMSQGEPRPSSSAVGPPDHTSDPPSPCGSPSSSQGADLSLPQTPDTHCP               141 - 199
//

Text Mined References (4)

PMID Year Title