Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.67
PubTator Score 4.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 3.96976607303644E-12
lung adenocarcinoma 2714 1.2252254649559E-11
glioblastoma multiforme 347 1.7645107274292E-10
lung carcinoma 2844 2.16585554426607E-9
cystic fibrosis 1670 2.17941129090915E-6
breast carcinoma 1614 4.25221822275448E-4
interstitial cystitis 2299 0.00259248530168971
ductal carcinoma in situ 1745 0.00389718101292366
invasive ductal carcinoma 2950 0.00400214679579783
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0121137298408768
fibroadenoma 557 0.0362379377618087

Expression

  Differential Expression (11)

Disease log2 FC p
glioblastoma multiforme 1.100 0.000
cystic fibrosis -1.774 0.000
non-small cell lung cancer -1.427 0.000
intraductal papillary-mucinous adenoma (... -1.100 0.012
breast carcinoma -1.500 0.000
fibroadenoma -1.500 0.036
interstitial cystitis 1.100 0.003
lung adenocarcinoma -1.700 0.000
lung carcinoma -1.100 0.000
ductal carcinoma in situ -1.400 0.004
invasive ductal carcinoma -1.700 0.004

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
26212012 data define a novel pathway that directs Lyn/Src family tyrosine kinase signals to sarcoma cell invadopodia through specific recruitment of Vav2 and Nck2 to phosphorylated AFAP1L1, to control cell migration and invasion
24723436 AFAP1L1 plays a role in the progression of colorectal cancer by modulating cell shape and motility and by inhibiting anoikis, presumably through interactions with vinculin-including protein complexes.
23326307 Findings indicate a role for transcription factor Sp3 in sarcomas as a driver for expression of the metastasis-related gene AFAP1L1 (actin filament-associated protein 1-like 1).
21516130 AFAP1L1 has a role in the progression of spindle cell sarcomas and is a prognostic biomarker.
21333378 Data suggest that AFAP1L1 may forge unique protein interactions in which AFAP1 is less efficient, and these interactions may allow AFAP1L1 to affect invadosome formation.

AA Sequence

MDRGQVLEQLLPELTGLLSLLDHEYLSDTTLEKKMAVASILQSLQPLPAKEVSYLYVNTADLHSGPSFVE      1 - 70
SLFEEFDCDLSDLRDMPEDDGEPSKGASPELAKSPRLRNAADLPPPLPNKPPPEDYYEEALPLGPGKSPE     71 - 140
YISSHNGCSPSHSIVDGYYEDADSSYPATRVNGELKSSYNDSDAMSSSYESYDEEEEEGKSPQPRHQWPS    141 - 210
EEASMHLVRECRICAFLLRKKRFGQWAKQLTVIREDQLLCYKSSKDRQPHLRLALDTCSIIYVPKDSRHK    211 - 280
RHELRFTQGATEVLVLALQSREQAEEWLKVIREVSKPVGGAEGVEVPRSPVLLCKLDLDKRLSQEKQTSD    281 - 350
SDSVGVGDNCSTLGRRETCDHGKGKKSSLAELKGSMSRAAGRKITRIIGFSKKKTLADDLQTSSTEEEVP    351 - 420
CCGYLNVLVNQGWKERWCRLKCNTLYFHKDHMDLRTHVNAIALQGCEVAPGFGPRHPFAFRILRNRQEVA    421 - 490
ILEASCSEDMGRWLGLLLVEMGSRVTPEALHYDYVDVETLTSIVSAGRNSFLYARSCQNQWPEPRVYDDV    491 - 560
PYEKMQDEEPERPTGAQVKRHASSCSEKSHRVDPQVKVKRHASSANQYKYGKNRAEEDARRYLVEKEKLE    561 - 630
KEKETIRTELIALRQEKRELKEAIRSSPGAKLKALEEAVATLEAQCRAKEERRIDLELKLVAVKERLQQS    631 - 700
LAGGPALGLSVSSKPKSGETANKPQNSVPEQPLPVNCVSELRKRSPSIVASNQGRVLQKAKEWEMKKT      701 - 768
//

Text Mined References (13)

PMID Year Title
26212012 2016 Regulation of sarcoma cell migration, invasion and invadopodia formation by AFAP1L1 through a phosphotyrosine-dependent pathway.
25416956 2014 A proteome-scale map of the human interactome network.
24723436 2014 AFAP1L1, a novel associating partner with vinculin, modulates cellular morphology and motility, and promotes the progression of colorectal cancers.
23326307 2013 The transcription factor Sp3 regulates the expression of a metastasis-related marker of sarcoma, actin filament-associated protein 1-like 1 (AFAP1L1).
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21516130 2011 Identification of AFAP1L1 as a prognostic marker for spindle cell sarcomas.
21333378 2011 AFAP1L1 is a novel adaptor protein of the AFAP family that interacts with cortactin and localizes to invadosomes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...