Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.32
PubTator Score 4.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
breast carcinoma -1.500 4.3e-04
cystic fibrosis -1.774 2.2e-06
ductal carcinoma in situ -1.400 3.9e-03
fibroadenoma -1.500 3.6e-02
glioblastoma 1.100 1.7e-03
interstitial cystitis 1.100 2.6e-03
intraductal papillary-mucinous adenoma (... -1.100 1.2e-02
invasive ductal carcinoma -1.700 4.0e-03
lung adenocarcinoma -1.100 1.8e-18
lung carcinoma -1.100 2.2e-09
non-small cell lung cancer -1.427 4.0e-12

Gene RIF (5)

AA Sequence

MDRGQVLEQLLPELTGLLSLLDHEYLSDTTLEKKMAVASILQSLQPLPAKEVSYLYVNTADLHSGPSFVE      1 - 70
SLFEEFDCDLSDLRDMPEDDGEPSKGASPELAKSPRLRNAADLPPPLPNKPPPEDYYEEALPLGPGKSPE     71 - 140
YISSHNGCSPSHSIVDGYYEDADSSYPATRVNGELKSSYNDSDAMSSSYESYDEEEEEGKSPQPRHQWPS    141 - 210
EEASMHLVRECRICAFLLRKKRFGQWAKQLTVIREDQLLCYKSSKDRQPHLRLALDTCSIIYVPKDSRHK    211 - 280
RHELRFTQGATEVLVLALQSREQAEEWLKVIREVSKPVGGAEGVEVPRSPVLLCKLDLDKRLSQEKQTSD    281 - 350
SDSVGVGDNCSTLGRRETCDHGKGKKSSLAELKGSMSRAAGRKITRIIGFSKKKTLADDLQTSSTEEEVP    351 - 420
CCGYLNVLVNQGWKERWCRLKCNTLYFHKDHMDLRTHVNAIALQGCEVAPGFGPRHPFAFRILRNRQEVA    421 - 490
ILEASCSEDMGRWLGLLLVEMGSRVTPEALHYDYVDVETLTSIVSAGRNSFLYARSCQNQWPEPRVYDDV    491 - 560
PYEKMQDEEPERPTGAQVKRHASSCSEKSHRVDPQVKVKRHASSANQYKYGKNRAEEDARRYLVEKEKLE    561 - 630
KEKETIRTELIALRQEKRELKEAIRSSPGAKLKALEEAVATLEAQCRAKEERRIDLELKLVAVKERLQQS    631 - 700
LAGGPALGLSVSSKPKSGETANKPQNSVPEQPLPVNCVSELRKRSPSIVASNQGRVLQKAKEWEMKKT      701 - 768
//

Text Mined References (13)

PMID Year Title