Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.89
PubTator Score 2.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
adrenocortical carcinoma 1427 1.58301089058354E-5
tuberculosis and treatment for 6 months 686 6.75914724984637E-5
cystic fibrosis 1670 5.31810920568843E-4
interstitial cystitis 2299 0.00393963703548947
primary Sjogren syndrome 789 0.00945221472497849
non-inflammatory breast cancer 208 0.018540672313414
ulcerative colitis 2087 0.0444276709764846
active Crohn's disease 918 0.0478928895839076
Disease Target Count Z-score Confidence
Caffey disease 6 5.253 2.6
Glycogen storage disease 37 4.18 2.1

Expression

  Differential Expression (8)

Disease log2 FC p
cystic fibrosis 1.062 0.001
adrenocortical carcinoma -1.746 0.000
tuberculosis and treatment for 6 months -1.500 0.000
active Crohn's disease -2.410 0.048
interstitial cystitis -1.400 0.004
primary Sjogren syndrome -1.200 0.009
non-inflammatory breast cancer 1.600 0.019
ulcerative colitis -1.300 0.044

Synonym

Accession Q8TED4 A8K2P9 Q6P599 Q7Z7P8 Q8TEM2
Symbols pp11662

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Opossum OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (1)

PMID Text
21949678 Data show that SLC37A1 and SLC37A2 are endoplasmic reticulum associated, P(i)-linked antiporters, that can transport glucose-6-phosphate.

AA Sequence

MRSSLAPGVWFFRAFSRDSWFRGLILLLTFLIYACYHMSRKPISIVKSRLHQNCSEQIKPINDTHSLNDT      1 - 70
MWCSWAPFDKDNYKELLGGVDNAFLIAYAIGMFISGVFGERLPLRYYLSAGMLLSGLFTSLFGLGYFWNI     71 - 140
HELWYFVVIQVCNGLVQTTGWPSVVTCVGNWFGKGKRGFIMGIWNSHTSVGNILGSLIAGIWVNGQWGLS    141 - 210
FIVPGIITAVMGVITFLFLIEHPEDVDCAPPQHHGEPAENQDNPEDPGNSPCSIRESGLETVAKCSKGPC    211 - 280
EEPAAISFFGALRIPGVVEFSLCLLFAKLVSYTFLYWLPLYIANVAHFSAKEAGDLSTLFDVGGIIGGIV    281 - 350
AGLVSDYTNGRATTCCVMLILAAPMMFLYNYIGQDGIASSIVMLIICGGLVNGPYALITTAVSADLGTHK    351 - 420
SLKGNAKALSTVTAIIDGTGSIGAALGPLLAGLISPTGWNNVFYMLISADVLACLLLCRLVYKEILAWKV    421 - 490
SLSRGSGYKEI                                                               491 - 501
//

Text Mined References (7)

PMID Year Title
21949678 2011 SLC37A1 and SLC37A2 are phosphate-linked, glucose-6-phosphate antiporters.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12811562 2004 The human sugar-phosphate/phosphate exchanger family SLC37.
12693554 2003 Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.