Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.84
PubTator Score 6.13

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8TED1 GPx-8
Symbols GPx-8
UNQ847
EPLA847
GSHPx-8

Gene

PANTHER Protein Class (2)

PDB

3CYN   3KIJ  

Gene RIF (4)

PMID Text
25557012 GPX8 is transcriptionally regulated by HIFalpha and modulates growth factor signaling in HeLa cells.
24566470 Along with the induction of GPX8 in ER-stressed cells, these findings question a ubiquitous role of Ero1alpha as a producer of cytoplasmic ROS under ER stress
23929719 Quantitative proteomics identifies the membrane-associated peroxidase GPx8 as a cellular substrate of the hepatitis C virus NS3-4A protease.
21215271 GPx8 labeled as secreted glutathione peroxidase, is actually endoplasmic reticulum-resident protein disulfide isomerase peroxidase

AA Sequence

MEPLAAYPLKCSGPRAKVFAVLLSIVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRTVSLEKYKGKVS      1 - 70
LVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKNYGVTFPIFHKI     71 - 140
KILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWKPEEPIEVIRPDIAALVRQVIIKKKEDL     141 - 209
//

Text Mined References (13)

PMID Year Title
25557012 2015 Glutathione peroxidase 8 is transcriptionally regulated by HIF? and modulates growth factor signaling in HeLa cells.
24566470 2014 GPx8 peroxidase prevents leakage of H2O2 from the endoplasmic reticulum.
23929719 2014 Quantitative proteomics identifies the membrane-associated peroxidase GPx8 as a cellular substrate of the hepatitis C virus NS3-4A protease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
21215271 2011 Two endoplasmic reticulum PDI peroxidases increase the efficiency of the use of peroxide during disulfide bond formation.
18498225 2008 Evolutionary and structural insights into the multifaceted glutathione peroxidase (Gpx) superfamily.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
More...