Property Summary

NCBI Gene PubMed Count 9
PubMed Score 8.62
PubTator Score 6.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
active Crohn's disease 3.564 1.9e-03
active ulcerative colitis 1.981 1.1e-02
adrenocortical carcinoma 2.498 9.3e-07
adult high grade glioma 2.000 2.1e-04
Astrocytoma, Pilocytic 1.700 1.8e-04
atypical teratoid / rhabdoid tumor 4.400 4.0e-11
diabetes mellitus -1.900 1.1e-02
Duchenne muscular dystrophy 1.358 6.6e-11
ependymoma 3.000 1.7e-14
glioblastoma 2.200 1.8e-05
interstitial cystitis 1.200 3.4e-04
intraductal papillary-mucinous carcinoma... -1.500 4.5e-02
invasive ductal carcinoma -1.100 2.1e-02
juvenile dermatomyositis 1.135 5.0e-11
medulloblastoma 1.500 4.0e-04
medulloblastoma, large-cell 2.300 1.5e-04
non-small cell lung cancer 1.892 1.2e-16
osteosarcoma 1.511 7.3e-03
ovarian cancer -1.800 6.5e-06
pancreatic cancer 1.200 3.3e-03
primary pancreatic ductal adenocarcinoma 1.784 1.8e-02
primitive neuroectodermal tumor 2.600 1.2e-04
subependymal giant cell astrocytoma 1.871 1.6e-02

Synonym

Accession Q8TED1 GPx-8
Symbols GPx-8
UNQ847
EPLA847
GSHPx-8

Gene

PANTHER Protein Class (2)

PDB

3CYN   3KIJ  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Protein-protein Interaction (2)

Gene RIF (4)

AA Sequence

MEPLAAYPLKCSGPRAKVFAVLLSIVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRTVSLEKYKGKVS      1 - 70
LVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKNYGVTFPIFHKI     71 - 140
KILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWKPEEPIEVIRPDIAALVRQVIIKKKEDL     141 - 209
//

Text Mined References (13)

PMID Year Title