Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.09
PubTator Score 3.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma 1.200 4.6e-07
medulloblastoma, large-cell 1.300 1.0e-04
intraductal papillary-mucinous neoplasm ... 1.500 1.9e-03
diabetes mellitus -1.300 1.1e-03
pediatric high grade glioma 1.100 9.7e-06
ovarian cancer 2.000 4.1e-06

 GO Function (1)

 GO Process (1)

Gene RIF (1)

PMID Text
23166591 Expression of HIV-1 Tat downregulates the abundance of UTP15, U3 small nucleolar ribonucleoprotein (UTP15) in the nucleoli of Jurkat T-cells

AA Sequence

MAGYKPVAIQTYPILGEKITQDTLYWNNYKTPVQIKEFGAVSKVDFSPQPPYNYAVTASSRIHIYGRYSQ      1 - 70
EPIKTFSRFKDTAYCATFRQDGRLLVAGSEDGGVQLFDISGRAPLRQFEGHTKAVHTVDFTADKYHVVSG     71 - 140
ADDYTVKLWDIPNSKEILTFKEHSDYVRCGCASKLNPDLFITGSYDHTVKMFDARTSESVLSVEHGQPVE    141 - 210
SVLLFPSGGLLVSAGGRYVKVWDMLKGGQLLVSLKNHHKTVTCLCLSSSGQRLLSGSLDRKVKVYSTTSY    211 - 280
KVVHSFDYAASILSLALAHEDETIVVGMTNGILSVKHRKSEAKKESLPRRRRPAYRTFIKGKNYMKQRDD    281 - 350
ILINRPAKKHLELYDRDLKHFRISKALDRVLDPTCTIKTPEITVSIIKELNRRGVLANALAGRDEKEISH    351 - 420
VLNFLIRNLSQPRFAPVLINAAEIIIDIYLPVIGQSPVVDKKFLLLQGLVEKEIDYQRELLETLGMMDML    421 - 490
FATMRRKEGTSVLEHTSDGFPENKKIES                                              491 - 518
//

Text Mined References (18)

PMID Year Title
24754225 2014 Dynamics of WD-repeat containing proteins in SSU processome components.
24219289 2013 Interaction, mobility, and phosphorylation of human orthologues of WD repeat-containing components of the yeast SSU processome t-UTP sub-complex.
22916032 2012 NOL11, implicated in the pathogenesis of North American Indian childhood cirrhosis, is required for pre-rRNA transcription and processing.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17567985 2007 Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes.
16381901 2006 The LIFEdb database in 2006.
16136320 2005 The perichromosomal layer.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.