Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.09
PubTator Score 3.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.300 0.000
intraductal papillary-mucinous neoplasm ... 1.500 0.002
diabetes mellitus -1.300 0.001
pediatric high grade glioma 1.100 0.000
ovarian cancer 2.000 0.000

Synonym

Accession Q8TED0 B4DU75 B4DXK8 Q6IA60 Q96E08 Q9H9F8
Symbols NET21

Gene

Gene RIF (1)

PMID Text
23166591 Expression of HIV-1 Tat downregulates the abundance of UTP15, U3 small nucleolar ribonucleoprotein (UTP15) in the nucleoli of Jurkat T-cells

AA Sequence

MAGYKPVAIQTYPILGEKITQDTLYWNNYKTPVQIKEFGAVSKVDFSPQPPYNYAVTASSRIHIYGRYSQ      1 - 70
EPIKTFSRFKDTAYCATFRQDGRLLVAGSEDGGVQLFDISGRAPLRQFEGHTKAVHTVDFTADKYHVVSG     71 - 140
ADDYTVKLWDIPNSKEILTFKEHSDYVRCGCASKLNPDLFITGSYDHTVKMFDARTSESVLSVEHGQPVE    141 - 210
SVLLFPSGGLLVSAGGRYVKVWDMLKGGQLLVSLKNHHKTVTCLCLSSSGQRLLSGSLDRKVKVYSTTSY    211 - 280
KVVHSFDYAASILSLALAHEDETIVVGMTNGILSVKHRKSEAKKESLPRRRRPAYRTFIKGKNYMKQRDD    281 - 350
ILINRPAKKHLELYDRDLKHFRISKALDRVLDPTCTIKTPEITVSIIKELNRRGVLANALAGRDEKEISH    351 - 420
VLNFLIRNLSQPRFAPVLINAAEIIIDIYLPVIGQSPVVDKKFLLLQGLVEKEIDYQRELLETLGMMDML    421 - 490
FATMRRKEGTSVLEHTSDGFPENKKIES                                              491 - 518
//

Text Mined References (18)

PMID Year Title
24754225 2014 Dynamics of WD-repeat containing proteins in SSU processome components.
24219289 2013 Interaction, mobility, and phosphorylation of human orthologues of WD repeat-containing components of the yeast SSU processome t-UTP sub-complex.
22916032 2012 NOL11, implicated in the pathogenesis of North American Indian childhood cirrhosis, is required for pre-rRNA transcription and processing.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17567985 2007 Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes.
16381901 2006 The LIFEdb database in 2006.
16136320 2005 The perichromosomal layer.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...