Property Summary

NCBI Gene PubMed Count 11
Grant Count 2
Funding $21,144.8
PubMed Score 3.71
PubTator Score 3.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession Q8TEC5 A8K961 Q08AM9 Q6GMR9 Q8N5S8 Q96LP8
Symbols HEPP1
POSHER
RNF158
PPP1R39

Gene

 Grant Application (2)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19945436 the novel protein heart protein phosphatase 1-binding protein (Hepp1), encoded by FLJ23654, was identified.Hepp1 can play a role in cardiac functions by working in concert with PP1.

AA Sequence

MDDLTLLDLLECPVCFEKLDVTAKVLPCQHTFCKPCLQRVFKAHKELRCPECRTPVFSNIEALPANLLLV      1 - 70
RLLDGVRSGQSSGRGGSFRRPGTMTLQDGRKSRTNPRRLQASPFRLVPNVRIHMDGVPRAKALCNYRGQN     71 - 140
PGDLRFNKGDIILLRRQLDENWYQGEINGISGNFPASSVEVIKQLPQPPPLCRALYNFDLRGKDKSENQD    141 - 210
CLTFLKDDIITVISRVDENWAEGKLGDKVGIFPILFVEPNLTARHLLEKNKGRQSSRTKNLSLVSSSSRG    211 - 280
NTSTLRRGPGSRRKVPGQFSITTALNTLNRMVHSPSGRHMVEISTPVLISSSNPSVITQPMEKADVPSSC    281 - 350
VGQVSTYHPAPVSPGHSTAVVSLPGSQQHLSANMFVALHSYSAHGPDELDLQKGEGVRVLGKCQDGWLRG    351 - 420
VSLVTGRVGIFPNNYVIPIFRKTSSFPDSRSPGLYTTWTLSTSSVSSQGSISEGDPRQSRPFKSVFVPTA    421 - 490
IVNPVRSTAGPGTLGQGSLRKGRSSMRKNGSLQRPLQSGIPTLVVGSLRRSPTMVLRPQQFQFYQPQGIP    491 - 560
SSPSAVVVEMGSKPALTGEPALTCISRGSEAWIHSAASSLIMEDKEIPIKSEPLPKPPASAPPSILVKPE    561 - 630
NSRNGIEKQVKTVRFQNYSPPPTKHYTSHPTSGKPEQPATLKASQPEAASLGPEMTVLFAHRSGCHSGQQ    631 - 700
TDLRRKSALGKATTLVSTASGTQTVFPSK                                             701 - 729
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22321011 Protein phosphatase 1? interacting proteins in the human brain.
22128169 2012 Sh3rf2/POSHER protein promotes cell survival by ring-mediated proteasomal degradation of the c-Jun N-terminal kinase scaffold POSH (Plenty of SH3s) protein.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19945436 2010 FLJ23654 encodes a heart protein phosphatase 1-binding protein (Hepp1).
19807924 2009 Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
More...