Property Summary

NCBI Gene PubMed Count 21
PubMed Score 10.14
PubTator Score 7.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (10)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 3.6e-06
atypical teratoid / rhabdoid tumor 1.500 6.3e-11
ependymoma 1.200 2.0e-11
glioblastoma 1.400 3.5e-06
medulloblastoma 1.300 4.8e-07
medulloblastoma, large-cell 1.300 1.9e-05
osteosarcoma -1.014 8.1e-04
primitive neuroectodermal tumor 1.100 2.5e-03
spina bifida -1.190 2.2e-02
tuberculosis 1.100 2.3e-06

Gene RIF (6)

AA Sequence

MQRRSRGINTGLILLLSQIFHVGINNIPPVTLATLALNIWFFLNPQKPLYSSCLSVEKCYQQKDWQRLLL      1 - 70
SPLHHADDWHLYFNMASMLWKGINLERRLGSRWFAYVITAFSVLTGVVYLLLQFAVAEFMDEPDFKRSCA     71 - 140
VGFSGVLFALKVLNNHYCPGGFVNILGFPVPNRFACWVELVAIHLFSPGTSFAGHLAGILVGLMYTQGPL    141 - 210
KKIMEACAGGFSSSVGYPGRQYYFNSSGSSGYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQA    211 - 280
SLWDRGNTRNSPPPYGFHLSPEEMRRQRLHRFDSQ                                       281 - 315
//

Text Mined References (22)

PMID Year Title