Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.23
PubTator Score 7.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ependymoma 2514 1.96881287246173E-11
atypical teratoid / rhabdoid tumor 4369 6.29139505445451E-11
medulloblastoma 1524 4.83335550027557E-7
osteosarcoma 7933 1.99028684505937E-6
tuberculosis 1563 2.33813490510546E-6
glioblastoma 5572 3.50625429989413E-6
pilocytic astrocytoma 3086 9.4061695794727E-6
medulloblastoma, large-cell 6234 1.90207186680544E-5
primitive neuroectodermal tumor 3031 0.00247669603906093
spina bifida 1064 0.0218452876494595

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -3.219 0.000
ependymoma 1.200 0.000
atypical teratoid / rhabdoid tumor 1.500 0.000
glioblastoma 1.400 0.000
medulloblastoma 1.300 0.000
medulloblastoma, large-cell 1.300 0.000
primitive neuroectodermal tumor 1.100 0.002
tuberculosis 1.100 0.000
pilocytic astrocytoma 1.200 0.000
spina bifida -1.190 0.022

Synonym

Accession Q8TEB9 Q495B9 Q53S43 Q5EBM8 Q6P5V8 Q8IV60 Q9H057 RRP4
Symbols RRP4

Gene

PDB

5EPP  

  Ortholog (13)

 GWAS Trait (1)

Pathway (1)

Gene RIF (5)

PMID Text
23883433 this study shows that RHBDD1 gene engineering could be used as an effective tool in malignant brain tumor therapy.
23669365 RHBDD1 could inhibit cell apoptosis by activating and upregulating c-Jun and its downstream target, Bcl-3
23534782 Our data show that in vitro RHBDD1 silencing regulates HepG2 cell proliferation and apoptosis.
22624035 RHBDD1 is involved in the regulation of a nonclassical exosomal secretion pathway through the restriction of TSAP6.
18953687 RHBDD1, a serine protease, modulates BIK-mediated apoptotic activity.

AA Sequence

MQRRSRGINTGLILLLSQIFHVGINNIPPVTLATLALNIWFFLNPQKPLYSSCLSVEKCYQQKDWQRLLL      1 - 70
SPLHHADDWHLYFNMASMLWKGINLERRLGSRWFAYVITAFSVLTGVVYLLLQFAVAEFMDEPDFKRSCA     71 - 140
VGFSGVLFALKVLNNHYCPGGFVNILGFPVPNRFACWVELVAIHLFSPGTSFAGHLAGILVGLMYTQGPL    141 - 210
KKIMEACAGGFSSSVGYPGRQYYFNSSGSSGYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQA    211 - 280
SLWDRGNTRNSPPPYGFHLSPEEMRRQRLHRFDSQ                                       281 - 315
//

Text Mined References (15)

PMID Year Title
23883433 2014 Lentiviral vector mediated delivery of RHBDD1 shRNA down regulated the proliferation of human glioblastoma cells.
23669365 2013 Rhomboid domain containing 1 inhibits cell apoptosis by upregulating AP-1 activity and its downstream target Bcl-3.
23534782 2013 Lentivirus-mediated silencing of rhomboid domain containing 1 suppresses tumor growth and induces apoptosis in hepatoma HepG2 cells.
22795130 2012 Ubiquitin-dependent intramembrane rhomboid protease promotes ERAD of membrane proteins.
22624035 2012 Exosome-related multi-pass transmembrane protein TSAP6 is a target of rhomboid protease RHBDD1-induced proteolysis.
18953687 2008 A novel member of the Rhomboid family, RHBDD1, regulates BIK-mediated apoptosis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17903307 2007 Framingham Heart Study genome-wide association: results for pulmonary function measures.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...