Property Summary

NCBI Gene PubMed Count 17
Grant Count 5
R01 Count 5
Funding $1,963,391
PubMed Score 19.80
PubTator Score 45.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
nephrosclerosis -1.080 0.011
malignant mesothelioma -7.800 0.000
astrocytic glioma -2.800 0.001
ependymoma -2.500 0.004
oligodendroglioma -2.700 0.002
esophageal adenocarcinoma 2.300 0.027
psoriasis -1.700 0.000
cutaneous lupus erythematosus -1.700 0.021
glioblastoma multiforme -2.100 0.000
osteosarcoma 1.232 0.047
medulloblastoma -3.100 0.000
atypical teratoid / rhabdoid tumor -3.000 0.000
medulloblastoma, large-cell -3.300 0.000
primitive neuroectodermal tumor -2.900 0.002
non-small cell lung cancer -1.800 0.000
intraductal papillary-mucinous adenoma (... 1.300 0.023
intraductal papillary-mucinous carcinoma... 1.700 0.010
intraductal papillary-mucinous neoplasm ... 2.200 0.013
colon cancer 2.100 0.013
lung cancer -3.400 0.000
pancreatic cancer 1.200 0.000
interstitial cystitis -5.100 0.000
cystic fibrosis -1.100 0.000
lung adenocarcinoma -1.600 0.000
adult high grade glioma -1.700 0.010
pilocytic astrocytoma 2.100 0.002
Breast cancer -3.500 0.000
lung carcinoma 1.300 0.000
breast carcinoma -1.200 0.000
ulcerative colitis -1.100 0.001
ovarian cancer -4.500 0.000

Gene RIF (8)

PMID Text
24356810 results show that expression of GRAIL is uniquely regulated by the specific miRNA in intestinal mucosa, and suggest that GRAIL may associate with the pathophysiology of Crohn's disease
23370271 study shows that Grail has a novel, p53-dependent role in regulating the cell cycle and apoptosis
19542455 GRAIL can down-modulate the expression of CD83 antigen on CD4 T cells.
19414743 endogenous GRAIL regulates general cell cycle and proliferation of primary naive CD4 T cells.
18713730 GRAIL captures and then ubiquitinates transmembrane proteins across the cell membrane
18467499 GRAIL expression was significantly higher in patients with ulcerative colitis in remission than in patients with active disease and in healthy volunteers.
17475842 Inhibition of T cell activation is not due to apoptosis or disruption of proximal T- cell receptor signaling, but is associated with up-regulation of GRAIL in CD4+ T cells, with modest effects on other E3 ubiquitin ligases.
17259178 Forced expression of GRAIL in a T cell line from a T-cell receptor transgenic mouse is sufficient for conversion of these cells to a regulatory phenotype.

AA Sequence

MGPPPGAGVSCRGGCGFSRLLAWCFLLALSPQAPGSRGAEAVWTAYLNVSWRVPHTGVNRTVWELSEEGV      1 - 70
YGQDSPLEPVAGVLVPPDGPGALNACNPHTNFTVPTVWGSTVQVSWLALIQRGGGCTFADKIHLAYERGA     71 - 140
SGAVIFNFPGTRNEVIPMSHPGAVDIVAIMIGNLKGTKILQSIQRGIQVTMVIEVGKKHGPWVNHYSIFF    141 - 210
VSVSFFIITAATVGYFIFYSARRLRNARAQSRKQRQLKADAKKAIGRLQLRTLKQGDKEIGPDGDSCAVC    211 - 280
IELYKPNDLVRILTCNHIFHKTCVDPWLLEHRTCPMCKCDILKALGIEVDVEDGSVSLQVPVSNEISNSA    281 - 350
SSHEEDNRSETASSGYASVQGTDEPPLEEHVQSTNESLQLVNHEANSVAVDVIPHVDNPTFEEDETPNQE    351 - 420
TAVREIKS                                                                  421 - 428
//

Text Mined References (18)

PMID Year Title
25635054 2015 CD81 promotes both the degradation of transferrin receptor 2 (TfR2) and the Tfr2-mediated maintenance of hepcidin expression.
25416956 2014 A proteome-scale map of the human interactome network.
24356810 2014 Regulation of anergy-related ubiquitin E3 ligase, GRAIL, in murine models of colitis and patients with Crohn's disease.
23370271 2013 Grail as a molecular determinant for the functions of the tumor suppressor p53 in tumorigenesis.
22016387 2011 GRAIL (gene related to anergy in lymphocytes) regulates cytoskeletal reorganization through ubiquitination and degradation of Arp2/3 subunit 5 and coronin 1A.
19542455 2009 The transmembrane E3 ligase GRAIL ubiquitinates and degrades CD83 on CD4 T cells.
19414743 2009 Naive CD4 t cell proliferation is controlled by mammalian target of rapamycin regulation of GRAIL expression.
18713730 2008 The single subunit transmembrane E3 ligase gene related to anergy in lymphocytes (GRAIL) captures and then ubiquitinates transmembrane proteins across the cell membrane.
18467499 2008 Upregulation of GRAIL is associated with remission of ulcerative colitis.
17475842 2007 Up-regulation of gene related to anergy in lymphocytes is associated with Notch-mediated human T cell suppression.
17259178 2007 GRAIL is up-regulated in CD4+ CD25+ T regulatory cells and is sufficient for conversion of T cells to a regulatory phenotype.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14661020 2004 Two isoforms of otubain 1 regulate T cell anergy via GRAIL.
12705856 2003 GRAIL: an E3 ubiquitin ligase that inhibits cytokine gene transcription is expressed in anergic CD4+ T cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.