Property Summary

NCBI Gene PubMed Count 17
PubMed Score 23.72
PubTator Score 45.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
adult high grade glioma -1.700 9.7e-03
astrocytic glioma -2.800 1.2e-03
Astrocytoma, Pilocytic 2.100 2.3e-03
atypical teratoid / rhabdoid tumor -3.000 4.6e-08
Breast cancer -3.500 1.6e-13
breast carcinoma -1.200 1.9e-10
colon cancer 2.100 1.3e-02
cutaneous lupus erythematosus -1.700 2.1e-02
cystic fibrosis -1.100 9.1e-05
ependymoma -2.500 4.4e-03
esophageal adenocarcinoma 2.300 2.7e-02
glioblastoma multiforme -2.100 3.4e-16
group 3 medulloblastoma -2.600 5.2e-03
interstitial cystitis -3.600 9.4e-03
intraductal papillary-mucinous adenoma (... 1.300 2.3e-02
intraductal papillary-mucinous carcinoma... 1.700 1.0e-02
intraductal papillary-mucinous neoplasm ... 2.200 1.3e-02
lung adenocarcinoma -1.600 8.4e-12
lung cancer -3.400 8.3e-05
lung carcinoma 1.300 3.8e-14
malignant mesothelioma -7.800 3.0e-10
medulloblastoma, large-cell -3.300 8.0e-05
nephrosclerosis -1.080 1.1e-02
non-small cell lung cancer -1.800 8.3e-08
oligodendroglioma -2.700 1.9e-03
osteosarcoma 1.232 4.7e-02
ovarian cancer -4.500 2.4e-15
pancreatic cancer 1.200 8.1e-05
primitive neuroectodermal tumor -2.900 2.0e-03
psoriasis -1.700 3.3e-07
ulcerative colitis -1.100 1.1e-03

Gene RIF (8)

AA Sequence

MGPPPGAGVSCRGGCGFSRLLAWCFLLALSPQAPGSRGAEAVWTAYLNVSWRVPHTGVNRTVWELSEEGV      1 - 70
YGQDSPLEPVAGVLVPPDGPGALNACNPHTNFTVPTVWGSTVQVSWLALIQRGGGCTFADKIHLAYERGA     71 - 140
SGAVIFNFPGTRNEVIPMSHPGAVDIVAIMIGNLKGTKILQSIQRGIQVTMVIEVGKKHGPWVNHYSIFF    141 - 210
VSVSFFIITAATVGYFIFYSARRLRNARAQSRKQRQLKADAKKAIGRLQLRTLKQGDKEIGPDGDSCAVC    211 - 280
IELYKPNDLVRILTCNHIFHKTCVDPWLLEHRTCPMCKCDILKALGIEVDVEDGSVSLQVPVSNEISNSA    281 - 350
SSHEEDNRSETASSGYASVQGTDEPPLEEHVQSTNESLQLVNHEANSVAVDVIPHVDNPTFEEDETPNQE    351 - 420
TAVREIKS                                                                  421 - 428
//

Text Mined References (18)

PMID Year Title