Property Summary

NCBI Gene PubMed Count 16
PubMed Score 5.31
PubTator Score 7.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma 1.100 2.5e-04
medulloblastoma, large-cell 1.100 1.2e-04
ovarian cancer 2.000 2.0e-05

Gene RIF (7)

AA Sequence

MKAVVQRVTRASVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESGKHWSKSVMDK      1 - 70
QYEILCVSQFTLQCVLKGNKPDFHLAMPTEQAEGFYNSFLEQLRKTYRPELIKDGKFGAYMQVHIQNDGP     71 - 140
VTIELESPAPGTATSDPKQLSKLEKQQQRKEKTRAKGPSESSKERNTPRKEDRSASSGAEGDVSSEREP     141 - 209
//

Text Mined References (26)

PMID Year Title