Property Summary

NCBI Gene PubMed Count 16
Grant Count 6
R01 Count 6
Funding $475,943.99
PubMed Score 5.31
PubTator Score 7.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.100 0.000
adult high grade glioma 1.100 0.000
ovarian cancer 2.000 0.000

Gene RIF (7)

PMID Text
25258324 The state of DUE-B phosphorylation is maintained by the equilibrium between Cdc7-dependent phosphorylation and PP2A-dependent dephosphorylation.
24772479 LDI-PCR revealed a fusion between DTD1 exon 4 and PDGFRB exon 12 in the cases with t(5;14)(q33;q32) and t(5;20)(q33;p11).
21479357 DTD1 variants do not affect the abnormalities of the upper airways in aspirin-intolerant asthma patients
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20065034 The coordinated binding of DUE-B and Cdc45 to origins and the physical interactions of DUE-B, Cdc45, and TopBP1 suggest that complexes of these proteins are necessary for replication initiation.
15653697 DUE-B, a c-myc DNA-unwinding element-binding protein, plays an important role in replication in vivo.
12392168 cloning and identification of novel cDNA which may be associated with FKBP25

AA Sequence

MKAVVQRVTRASVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESGKHWSKSVMDK      1 - 70
QYEILCVSQFTLQCVLKGNKPDFHLAMPTEQAEGFYNSFLEQLRKTYRPELIKDGKFGAYMQVHIQNDGP     71 - 140
VTIELESPAPGTATSDPKQLSKLEKQQQRKEKTRAKGPSESSKERNTPRKEDRSASSGAEGDVSSEREP     141 - 209
//

Text Mined References (26)

PMID Year Title
25258324 2014 Protein phosphatase 2A and Cdc7 kinase regulate the DNA unwinding element-binding protein in replication initiation.
24772479 2014 Identification and functional characterization of imatinib-sensitive DTD1-PDGFRB and CCDC88C-PDGFRB fusion genes in eosinophilia-associated myeloid/lymphoid neoplasms.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21479357 2011 Association analysis of DTD1 gene variations with aspirin-intolerance in asthmatics.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...