Property Summary

NCBI Gene PubMed Count 16
PubMed Score 5.31
PubTator Score 7.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 2.00376229430809E-5
medulloblastoma, large-cell 6234 1.22428865925801E-4
adult high grade glioma 2148 2.48764946970159E-4

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.100 0.000
adult high grade glioma 1.100 0.000
ovarian cancer 2.000 0.000

Synonym

Accession Q8TEA8 A8K5X5 D3DW37 Q496D1 Q5W184 Q8WXU8 Q9BW67 Q9H464 Q9H474
Symbols DUEB
DUE-B
HARS2
pqn-68
C20orf88

Gene

PANTHER Protein Class (2)

PDB

2OKV  

  Ortholog (16)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (7)

PMID Text
25258324 The state of DUE-B phosphorylation is maintained by the equilibrium between Cdc7-dependent phosphorylation and PP2A-dependent dephosphorylation.
24772479 LDI-PCR revealed a fusion between DTD1 exon 4 and PDGFRB exon 12 in the cases with t(5;14)(q33;q32) and t(5;20)(q33;p11).
21479357 DTD1 variants do not affect the abnormalities of the upper airways in aspirin-intolerant asthma patients
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20065034 The coordinated binding of DUE-B and Cdc45 to origins and the physical interactions of DUE-B, Cdc45, and TopBP1 suggest that complexes of these proteins are necessary for replication initiation.
15653697 DUE-B, a c-myc DNA-unwinding element-binding protein, plays an important role in replication in vivo.
12392168 cloning and identification of novel cDNA which may be associated with FKBP25

AA Sequence

MKAVVQRVTRASVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESGKHWSKSVMDK      1 - 70
QYEILCVSQFTLQCVLKGNKPDFHLAMPTEQAEGFYNSFLEQLRKTYRPELIKDGKFGAYMQVHIQNDGP     71 - 140
VTIELESPAPGTATSDPKQLSKLEKQQQRKEKTRAKGPSESSKERNTPRKEDRSASSGAEGDVSSEREP     141 - 209
//

Text Mined References (26)

PMID Year Title
25258324 2014 Protein phosphatase 2A and Cdc7 kinase regulate the DNA unwinding element-binding protein in replication initiation.
24772479 2014 Identification and functional characterization of imatinib-sensitive DTD1-PDGFRB and CCDC88C-PDGFRB fusion genes in eosinophilia-associated myeloid/lymphoid neoplasms.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21479357 2011 Association analysis of DTD1 gene variations with aspirin-intolerance in asthmatics.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...