Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.94
PubTator Score 1.25

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
26160102 Findings identified NSUN6 as a novel mammalian m5C tRNA methyltransferase and suggest that methylation of tRNAs by NSUN6 occurs during a late step of tRNA biogenesis, after the addition of the CCA tail and export of the tRNA from the nucleus.
21044367 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPPSFTTVRVNTHLASVQHVKNL      1 - 70
LLDELQKQFNGLSVPILQHPDLQDVLLIPVIGPRKNIKKQQCEAIVGAQCGNAVLRGAHVYAPGIVSASQ     71 - 140
FMKAGDVISVYSDIKGKCKKGAKEFDGTKVFLGNGISELSRKEIFSGLPELKGMGIRMTEPVYLSPSFDS    141 - 210
VLPRYLFLQNLPSALVSHVLNPQPGEKILDLCAAPGGKTTHIAALMHDQGEVIALDKIFNKVEKIKQNAL    211 - 280
LLGLNSIRAFCFDGTKAVKLDMVEDTEGEPPFLPESFDRILLDAPCSGMGQRPNMACTWSVKEVASYQPL    281 - 350
QRKLFTAAVQLLKPEGVLVYSTCTITLAENEEQVAWALTKFPCLQLQPQEPQIGGEGMRGAGLSCEQLKQ    351 - 420
LQRFDPSAVPLPDTDMDSLREARREDMLRLANKDSIGFFIAKFVKCKST                         421 - 469
//

Text Mined References (12)

PMID Year Title
26160102 2015 NSUN6 is a human RNA methyltransferase that catalyzes formation of m5C72 in specific tRNAs.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
21269460 2011 Initial characterization of the human central proteome.
21044367 2010 An integrative method for scoring candidate genes from association studies: application to warfarin dosing.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
More...