Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.94
PubTator Score 1.25

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8TEA1 B0YJ54
Symbols NOPD1
ARL5B-AS1
4933414E04Rik

Gene

PDB

5WWQ   5WWR   5WWS   5WWT  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MSIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPPSFTTVRVNTHLASVQHVKNL      1 - 70
LLDELQKQFNGLSVPILQHPDLQDVLLIPVIGPRKNIKKQQCEAIVGAQCGNAVLRGAHVYAPGIVSASQ     71 - 140
FMKAGDVISVYSDIKGKCKKGAKEFDGTKVFLGNGISELSRKEIFSGLPELKGMGIRMTEPVYLSPSFDS    141 - 210
VLPRYLFLQNLPSALVSHVLNPQPGEKILDLCAAPGGKTTHIAALMHDQGEVIALDKIFNKVEKIKQNAL    211 - 280
LLGLNSIRAFCFDGTKAVKLDMVEDTEGEPPFLPESFDRILLDAPCSGMGQRPNMACTWSVKEVASYQPL    281 - 350
QRKLFTAAVQLLKPEGVLVYSTCTITLAENEEQVAWALTKFPCLQLQPQEPQIGGEGMRGAGLSCEQLKQ    351 - 420
LQRFDPSAVPLPDTDMDSLREARREDMLRLANKDSIGFFIAKFVKCKST                         421 - 469
//

Text Mined References (15)

PMID Year Title